SimulationCraft 1100-02

for World of Warcraft 11.0.7.58911 Live (hotfix 2025-02-03/58911, git build d2465f0)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Evoker

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-01-20 Ebon Might is 5%
Ebon Might (effect#1) base_value 5.00 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Combo 1 : 1,464,895 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,464,895.31,464,895.32,814.3 / 0.192%194,558.6 / 13.3%48,989.1
Resource Out In Waiting APM Active
Energy29.929.711.66%57.1100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 11,464,895
Auto Attack 0 (70,435)0.0% (4.8%)3.9122.16s5,389,8350

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 47,0453.2%355.40.98s39,74140,633Direct355.438,37777,44139,73819.5%16.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage355.43355.430.000.000.000.97800.000014,125,132.5818,427,831.1223.35%40,633.4840,633.48
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.18%228.1215630238,377.0122,77364,93038,390.3036,42340,3258,755,03311,422,89323.36%
crit19.51%69.354010877,441.2145,615130,05577,489.1970,16386,4905,370,1007,004,93823.34%
miss16.31%57.9630860.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,3901.6%354.80.99s19,79220,172Direct354.819,12538,59119,78819.4%16.3%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage354.76354.760.000.000.000.98110.00007,021,312.679,159,627.9123.35%20,172.1320,172.13
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.31%228.1515829619,124.9611,44332,33319,132.9318,28720,1504,363,2975,692,70323.35%
crit19.41%68.873710838,591.4924,05564,76238,623.5934,74142,8152,658,0153,466,92523.33%
miss16.28%57.7431880.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,3302.1%75.63.66s120,803120,262Direct75.672,929188,468120,78141.4%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.5575.550.000.000.001.00450.00009,126,677.2411,939,790.3823.56%120,261.92120,261.92
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit58.57%44.25206872,928.6657,139141,74572,942.5268,11177,7673,227,2224,224,05223.59%
crit41.43%31.301551188,468.05125,912385,067188,531.75171,929213,6645,899,4557,715,73923.56%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.53

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 89,398 (127,661)6.1% (8.7%)13.322.30s2,880,0732,391,182Direct39.9 (78.2)520,0041,044,923673,28929.2% (29.3%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.3139.860.000.000.001.20450.000026,839,164.0134,943,573.8223.19%2,391,182.162,391,182.16
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.76%28.201342520,004.42119,7431,904,046520,344.73338,788711,14114,663,50319,091,36823.20%
crit29.24%11.652221,044,922.75239,8463,913,4381,047,229.42367,2241,853,17212,175,66115,852,20623.20%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.31
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 38,2632.6%0.00.00s00Direct38.4230,305466,256299,32229.3%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.360.000.000.000.00000.000011,484,312.4711,484,312.470.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.71%27.121443230,305.1157,087841,136230,492.10149,760310,3676,246,0206,246,0200.00%
crit29.29%11.24321466,255.59114,3451,697,789467,599.67248,075996,4195,238,2935,238,2930.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (19,888)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 19,8881.4%22.113.12s269,6370Direct22.1269,7060269,7060.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.1422.140.000.000.000.00000.00005,970,885.615,970,885.610.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.141140269,706.26260,578318,025269,702.29263,337280,1985,970,8865,970,8860.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 256,284 (366,744)17.5% (25.0%)68.84.40s1,598,9321,591,786Direct68.8 (136.4)857,3581,756,2881,117,53229.0% (28.9%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.8068.800.000.000.001.00450.000076,879,967.66100,002,891.8123.12%1,591,786.441,591,786.44
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.04%48.883368857,357.67210,8622,519,795857,055.09689,0601,049,57141,894,73454,501,24823.13%
crit28.96%19.938351,756,288.02422,3575,177,9811,754,776.551,164,8992,431,23934,985,23445,501,64423.11%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.80

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 110,4607.5%67.64.46s490,3590Direct67.6376,457770,569490,50228.9%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.5767.570.000.000.000.00000.000033,131,576.6733,131,576.670.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.07%48.023269376,456.66100,5271,121,514376,352.22313,301446,21018,069,25718,069,2570.00%
crit28.93%19.55735770,568.68201,3562,093,121770,988.84544,2501,038,79215,062,32015,062,3200.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,031 (21,048)0.1% (1.4%)3.791.38s1,703,8181,696,226Direct3.7 (27.6)69,720139,36883,28219.5% (19.8%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000308,966.73308,966.730.00%1,696,226.391,696,226.39
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.50%2.990469,719.5260,925138,60269,298.960104,186208,152208,1520.00%
crit19.50%0.7204139,367.60122,033255,48374,775.680255,483100,814100,8140.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.71
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 20,0171.4%0.00.00s00Direct23.9209,360421,548251,44319.9%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.890.000.000.000.00000.00006,009,476.586,009,476.580.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.12%19.14927209,359.8877,405451,823209,144.00173,268247,4134,007,1134,007,1130.00%
crit19.88%4.75012421,547.85165,752862,952417,835.460770,5002,002,3632,002,3630.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,2070.8%0.00.00s00Direct283.910,79121,72112,90319.3%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00283.910.000.000.000.00000.00003,663,512.443,663,512.440.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.67%229.0515331810,790.717,51417,72310,794.9510,17211,3782,471,5992,471,5990.00%
crit19.33%54.87248921,721.1915,05135,50021,731.2119,18824,6881,191,9131,191,9130.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 98,700 (116,879)6.7% (8.0%)9.531.21s3,676,7263,660,617Periodic167.7 (335.3)135,881280,761176,74728.2% (28.2%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.540.00167.66167.667.071.00451.740329,627,469.9329,627,469.930.00%116,419.853,660,617.12
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.80%120.3788160135,880.57143426,096135,936.68119,895156,86916,353,30316,353,3030.00%
crit28.20%47.282269280,760.61373864,789280,977.75209,889351,78213,274,16713,274,1670.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.54
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,1791.2%167.71.76s32,5420Periodic167.724,95851,85432,55028.2%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.660.000.00167.660.000.00000.00005,455,884.545,455,884.540.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.77%120.338416224,957.559,67179,16624,972.1021,88828,1253,002,9293,002,9290.00%
crit28.23%47.33257751,854.3119,371156,49351,918.6340,22164,0102,452,9552,452,9550.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (271,659)0.0% (18.5%)16.118.92s5,077,3535,054,950

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.060.000.000.000.001.00450.00000.000.000.00%5,054,949.835,054,949.83

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.05
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,6274.8%0.00.00s00Direct16.1686,9092,109,2301,301,66843.2%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.060.000.000.000.00000.000020,889,172.7327,228,881.8723.28%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.80%9.12314686,908.90150,6161,572,799688,090.99485,800993,3226,261,7978,184,79623.50%
crit43.20%6.943122,109,230.25301,6844,232,4192,150,165.921,299,1273,348,06414,627,37619,044,08623.19%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 202,03113.8%0.00.00s00Direct32.0995,1823,024,5131,893,99344.3%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0032.020.000.000.000.00000.000060,637,058.2160,637,058.210.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.69%17.83927995,181.93221,6202,368,799995,862.42709,4631,295,46117,731,57217,731,5720.00%
crit44.31%14.196243,024,512.60466,1016,120,5813,058,042.062,115,5454,484,00542,905,48742,905,4870.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (104,698)0.0% (7.1%)3.790.84s8,604,4010

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.66
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 104,6987.1%385.01.20s81,6460Periodic385.081,632081,6320.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage385.000.000.00385.000.000.00000.000031,433,705.6131,433,705.610.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%385.0029047781,631.91431,174,36681,697.2367,48197,57631,433,70631,433,7060.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8717.59
  • base_dd_max:8717.59
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 117,7558.0%52.45.88s673,398670,393Direct52.4280,429916,923673,35661.8%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.4152.410.000.000.001.00450.000035,290,135.6346,012,041.2223.30%670,392.58670,392.58
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.24%20.041132280,429.37130,261417,543280,505.71247,373312,5055,620,7217,323,11923.25%
crit61.76%32.362143916,922.96287,0431,411,743917,568.58830,314989,09529,669,41438,688,92223.31%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.40

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,5840.2%2.379.25s476,8620Direct2.3400,848803,311476,98218.9%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.262.260.000.000.000.00000.00001,079,812.901,079,812.900.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.12%1.8408400,848.39377,346480,343338,380.000474,116736,376736,3760.00%
crit18.88%0.4304803,310.69755,824949,931273,018.880949,931343,437343,4370.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8590.1%2.469.76s109,5030Direct2.491,544183,447109,52219.5%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.362.360.000.000.000.00000.0000257,881.82257,881.820.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.48%1.900791,543.5583,958120,19377,734.280119,804173,521173,5210.00%
crit19.52%0.4604183,446.64168,168239,96868,094.770223,78684,36184,3610.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67920.01
  • base_dd_max:67920.01
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 47,1453.2%19.115.22s741,2550Periodic107.3131,8520131,8520.0%0.0%71.5%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.100.00107.35107.3512.130.00002.000014,156,509.2714,156,509.270.00%65,939.300.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.3566157131,851.7760,995220,946130,989.5082,631175,17914,156,50914,156,5090.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 64,2514.4%32.49.08s595,6790Direct32.4498,710999,595595,47619.3%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage32.4232.420.000.000.000.00000.000019,311,484.5019,311,484.500.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.65%26.151246498,709.93453,001886,358498,486.91459,901557,45513,040,20913,040,2090.00%
crit19.35%6.27016999,595.47907,3601,703,405996,334.7601,365,2426,271,2756,271,2750.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,5370.3%2.473.81s571,8860Direct2.4481,259962,877572,23318.8%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.372.370.000.000.000.00000.00001,357,170.201,357,170.200.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.19%1.9308481,259.10452,539577,129417,602.980565,715927,318927,3180.00%
crit18.81%0.4504962,877.47906,4361,139,222341,211.4401,139,222429,853429,8530.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 85,2155.8%58.25.17s439,9410Direct58.2367,865737,905439,97819.5%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.1758.170.000.000.000.00000.000025,589,420.2533,424,644.2223.44%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.51%46.832865367,865.34220,828572,381367,982.84335,053400,51717,225,45722,502,06523.45%
crit19.49%11.34322737,904.70442,3191,119,858738,583.49510,837909,5818,363,96310,922,57923.43%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 1
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.67s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.560.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.792.34s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.720.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.411.74s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.410.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.371.40s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.280.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.367.99s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.330.0054.830.000.240.00000.83460.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5310.63s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.490.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.49
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 99.03.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.970.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.377.27s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.290.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.25s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.340.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.34
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.469.76s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.362.360.000.000.000.00000.00000.001,615,945.220.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.36090.00000.000001,615,94590.61%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8590.1%2.469.76s109,5030Direct2.491,544183,447109,52219.5%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.362.360.000.000.000.00000.0000257,881.82257,881.820.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.48%1.900791,543.5583,958120,19377,734.280119,804173,521173,5210.00%
crit19.52%0.4604183,446.64168,168239,96868,094.770223,78684,36184,3610.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67920.01
  • base_dd_max:67920.01
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.321.44s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.310.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.31
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.16s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.92
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.374.39s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.350.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1593.4163.7s0.5s279.9s99.94%100.00%583.8 (583.8)0.1

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:3.2s / 341.0s
  • trigger_min/max:0.0s / 4.2s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 359.9s
  • uptime_min/max:99.14% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.17%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.15%
  • acrobatic_strikes_7:0.16%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.35%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.4115.3s3.5s126.8s97.29%0.00%74.0 (76.8)1.3

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.1s / 333.1s
  • trigger_min/max:1.0s / 45.2s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 357.6s
  • uptime_min/max:88.15% / 99.44%

Stack Uptimes

  • alacrity_1:3.00%
  • alacrity_2:2.19%
  • alacrity_3:1.85%
  • alacrity_4:1.67%
  • alacrity_5:88.58%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.50%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.10.018.9s18.9s6.9s37.04%100.00%0.0 (0.0)15.7

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 57.2s
  • trigger_min/max:9.2s / 57.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:31.81% / 40.91%

Stack Uptimes

  • bolstering_shadows_1:37.04%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.6s90.6s0.2s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:83.2s / 103.4s
  • trigger_min/max:83.2s / 103.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.08%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.20.0130.4s110.2s4.4s1.80%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 279.2s
  • trigger_min/max:90.0s / 186.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.7s
  • uptime_min/max:0.00% / 9.68%

Stack Uptimes

  • cryptic_instructions_1:1.81%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.348.123.1s23.1s8.2s36.48%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 70.2s
  • trigger_min/max:8.0s / 70.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.21% / 39.13%

Stack Uptimes

  • danse_macabre_1:0.03%
  • danse_macabre_2:4.55%
  • danse_macabre_3:6.58%
  • danse_macabre_4:16.56%
  • danse_macabre_5:8.74%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.540.8s3.7s35.5s90.18%95.71%74.5 (74.5)6.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 172.8s
  • trigger_min/max:1.0s / 41.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 162.5s
  • uptime_min/max:81.58% / 96.39%

Stack Uptimes

  • deeper_daggers_1:90.18%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.10.018.9s18.9s3.4s18.40%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 57.2s
  • trigger_min/max:9.2s / 57.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:14.54% / 22.06%

Stack Uptimes

  • disorienting_strikes_1:12.21%
  • disorienting_strikes_2:6.19%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0130.4s110.0s4.0s1.63%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 286.6s
  • trigger_min/max:90.0s / 190.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.4s
  • uptime_min/max:0.00% / 6.65%

Stack Uptimes

  • errant_manaforge_emission_1:1.63%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.144.022.1s5.2s17.3s81.53%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 64.6s
  • trigger_min/max:1.0s / 24.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 60.3s
  • uptime_min/max:63.40% / 92.90%

Stack Uptimes

  • escalating_blade_1:25.10%
  • escalating_blade_2:22.07%
  • escalating_blade_3:22.53%
  • escalating_blade_4:11.82%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.8s90.8s14.7s18.14%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:82.6s / 183.7s
  • trigger_min/max:82.6s / 183.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:11.16% / 20.89%

Stack Uptimes

  • ethereal_powerlink_1:18.14%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.00.282.5s69.6s15.4s10.45%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4732.37

Trigger Details

  • interval_min/max:15.1s / 314.8s
  • trigger_min/max:0.3s / 314.8s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 39.9s
  • uptime_min/max:0.00% / 36.51%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.45%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.8s14.63%0.00%14.4 (96.6)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.1s
  • trigger_min/max:1.0s / 92.5s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s
  • uptime_min/max:12.97% / 16.87%

Stack Uptimes

  • flagellation_buff_1:1.32%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.77%
  • flagellation_buff_9:0.59%
  • flagellation_buff_10:0.56%
  • flagellation_buff_11:0.47%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.71%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.05%
  • flagellation_buff_19:0.41%
  • flagellation_buff_20:0.37%
  • flagellation_buff_21:0.32%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.01%
  • flagellation_buff_24:0.19%
  • flagellation_buff_25:0.86%
  • flagellation_buff_26:0.38%
  • flagellation_buff_27:0.19%
  • flagellation_buff_28:0.21%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.09%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.9s14.19%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.3s / 98.1s
  • trigger_min/max:78.3s / 98.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.40% / 16.23%

Stack Uptimes

  • flagellation_persist_7:0.00%
  • flagellation_persist_13:0.00%
  • flagellation_persist_26:0.00%
  • flagellation_persist_30:14.18%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6113.1s76.7s35.5s24.88%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 335.0s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 77.47%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.88%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6112.8s76.6s35.6s25.11%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.5s / 330.0s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 76.22%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.11%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6112.5s76.9s35.2s25.22%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 300.0s
  • trigger_min/max:30.0s / 270.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 75.19%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.22%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.2s77.1s35.0s24.79%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.4s / 338.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 75.65%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.79%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.50.039.8s3.4s59.8s95.31%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.60%
  • flawless_form_2:8.74%
  • flawless_form_3:11.84%
  • flawless_form_4:9.67%
  • flawless_form_5:2.70%
  • flawless_form_6:4.44%
  • flawless_form_7:5.89%
  • flawless_form_8:11.36%
  • flawless_form_9:18.54%
  • flawless_form_10:8.80%
  • flawless_form_11:1.41%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.01%
  • flawless_form_15:0.16%
  • flawless_form_16:0.08%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)2.00.284.1s72.2s16.9s11.20%0.00%0.2 (0.2)1.3

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:4.8s / 312.9s
  • trigger_min/max:0.2s / 312.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 64.1s
  • uptime_min/max:0.00% / 38.42%

Stack Uptimes

  • nascent_empowerment_Crit_1:11.20%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)2.00.284.4s71.5s16.8s11.01%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.5s / 314.3s
  • trigger_min/max:0.3s / 314.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.1s
  • uptime_min/max:0.00% / 38.24%

Stack Uptimes

  • nascent_empowerment_Haste_1:11.01%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)2.00.286.4s73.1s16.9s10.99%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.5s / 334.0s
  • trigger_min/max:0.3s / 320.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 48.5s
  • uptime_min/max:0.00% / 40.72%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.99%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.284.5s72.2s16.7s10.83%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.5s / 318.7s
  • trigger_min/max:0.0s / 318.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.9s
  • uptime_min/max:0.00% / 43.11%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.83%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.90.422.1s21.3s3.7s16.99%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.1s / 85.3s
  • trigger_min/max:1.0s / 65.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.1s
  • uptime_min/max:8.79% / 26.00%

Stack Uptimes

  • poised_shadows_1:16.99%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.30.017.9s18.9s1.1s2.59%11.23%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.8s
  • trigger_min/max:1.0s / 65.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.38% / 4.80%

Stack Uptimes

  • premeditation_1:2.59%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.30.0126.8s113.1s4.0s1.67%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.0s
  • trigger_min/max:90.0s / 187.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 10.9s
  • uptime_min/max:0.00% / 7.07%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.67%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.10.283.2s72.3s15.2s10.80%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:23922.58

Trigger Details

  • interval_min/max:15.0s / 321.3s
  • trigger_min/max:1.0s / 321.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.3s
  • uptime_min/max:0.00% / 39.11%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.80%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.70.090.9s90.9s15.8s19.16%17.11%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.3s
  • trigger_min/max:90.0s / 98.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 16.0s
  • uptime_min/max:16.89% / 21.87%

Stack Uptimes

  • shadow_blades_1:19.16%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.1s23.1s8.2s36.48%100.00%0.0 (0.0)13.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 70.2s
  • trigger_min/max:8.0s / 70.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.21% / 39.13%

Stack Uptimes

  • shadow_dance_1:36.48%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.4139.04.4s1.4s3.5s79.09%95.46%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 47.7s
  • trigger_min/max:0.5s / 6.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.2s
  • uptime_min/max:70.17% / 87.30%

Stack Uptimes

  • shadow_techniques_1:20.54%
  • shadow_techniques_2:20.84%
  • shadow_techniques_3:9.43%
  • shadow_techniques_4:10.47%
  • shadow_techniques_5:6.08%
  • shadow_techniques_6:5.81%
  • shadow_techniques_7:2.58%
  • shadow_techniques_8:2.33%
  • shadow_techniques_9:0.51%
  • shadow_techniques_10:0.44%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.01%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s298.4s99.32%87.72%99.0 (99.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.0s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.60.0103.2s98.0s9.9s1.98%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:6.0s / 321.2s
  • trigger_min/max:1.0s / 321.2s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 19.4s
  • uptime_min/max:0.00% / 16.08%

Stack Uptimes

  • storm_sewers_citrine_1:1.98%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.098.0s89.5s9.9s1.85%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.1s / 326.1s
  • trigger_min/max:2.0s / 323.2s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 17.8s
  • uptime_min/max:0.00% / 16.54%

Stack Uptimes

  • storm_sewers_citrine_1:1.85%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.0107.9s99.7s9.9s1.97%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:4.0s / 303.7s
  • trigger_min/max:1.1s / 303.7s
  • trigger_pct:100.00%
  • duration_min/max:1.1s / 19.4s
  • uptime_min/max:0.00% / 11.74%

Stack Uptimes

  • storm_sewers_citrine_1:1.97%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.10.283.5s70.9s15.5s10.77%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1395.02
  • stat:haste_rating
  • amount:1395.02
  • stat:mastery_rating
  • amount:1395.02
  • stat:versatility_rating
  • amount:1395.02

Trigger Details

  • interval_min/max:15.1s / 321.2s
  • trigger_min/max:0.9s / 321.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 42.3s
  • uptime_min/max:0.00% / 36.78%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.77%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.4s21.4s2.3s11.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 65.8s
  • trigger_min/max:3.0s / 65.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.9s
  • uptime_min/max:9.18% / 14.42%

Stack Uptimes

  • supercharge_1_1:11.00%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.06%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.8s
  • trigger_min/max:1.0s / 65.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.9s
  • uptime_min/max:0.71% / 5.95%

Stack Uptimes

  • supercharge_2_1:2.06%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.4s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 2.0s
  • uptime_min/max:0.00% / 0.69%

Stack Uptimes

  • supercharge_3_1:0.00%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.56.843.5s21.3s24.5s61.12%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.1s / 95.9s
  • trigger_min/max:1.0s / 65.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.0s
  • uptime_min/max:57.71% / 65.18%

Stack Uptimes

  • symbols_of_death_1:61.12%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.8s307.8s27.6s13.43%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.1s
  • trigger_min/max:300.0s / 329.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s
  • uptime_min/max:9.96% / 18.10%

Stack Uptimes

  • tempered_potion_1:13.43%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.69%3.79%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.40% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.69%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.4s21.3s2.9s13.76%22.28%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 65.8s
  • trigger_min/max:1.0s / 65.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.4s
  • uptime_min/max:11.30% / 17.10%

Stack Uptimes

  • the_rotten_1:10.74%
  • the_rotten_2:3.02%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.3s122.3s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 137.4s
  • trigger_min/max:120.0s / 137.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.38%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.0120.6s34.7s15.5s0.57%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4550.35

Trigger Details

  • interval_min/max:48.9s / 243.4s
  • trigger_min/max:1.0s / 243.4s
  • trigger_pct:100.00%
  • duration_min/max:7.3s / 27.5s
  • uptime_min/max:0.00% / 12.37%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.62%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.00.284.4s72.0s15.3s10.31%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5720.08

Trigger Details

  • interval_min/max:15.1s / 332.6s
  • trigger_min/max:1.0s / 332.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.1s
  • uptime_min/max:0.00% / 34.59%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.31%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.826.080.06.0s0.7s61.2s
Skyfury (Off Hand)49.627.077.06.0s0.7s62.5s
Supercharger secret_technique12.58.016.023.6s9.2s92.0s
Cold Blood secret_technique3.63.04.090.6s83.2s103.4s
Supercharger rupture0.30.02.0161.3s48.4s239.0s
Supercharger coup_de_grace2.80.09.078.2s10.2s305.3s
Supercharger eviscerate13.05.020.023.2s1.0s144.8s
CP Spent During Flagellation202.5136.0247.011.2s1.0s93.5s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.41%6.07%14.36%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 1
Energy RegenEnergy1,439.123,041.0534.09%2.11399.7611.62%
Improved AmbushCombo Points52.4033.614.58%0.6418.7935.86%
PremeditationCombo Points17.2557.047.78%3.3163.7052.75%
Relentless StrikesEnergy107.714,285.7948.05%39.79123.302.80%
Shadow BladesCombo Points21.91113.7415.50%5.1917.7113.47%
Shadow TechniquesEnergy361.041,237.6213.87%3.43206.5314.30%
Shadow TechniquesCombo Points85.85241.6232.94%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.38107.6314.67%7.000.000.00%
BackstabCombo Points75.5375.1810.25%1.000.350.47%
ShadowstrikeCombo Points52.40104.7714.28%2.000.040.04%
Symbols of DeathEnergy14.30355.673.99%24.87216.4737.84%
Usage Type Count Total Tot% Avg RPE APR
Combo 1
BackstabEnergy75.533,021.3733.67%40.0039.993,020.71
Coup de GraceEnergy13.31465.795.19%35.0035.0082,276.09
Coup de GraceCombo Points13.3190.9112.46%6.836.83421,575.43
EviscerateEnergy68.802,408.1226.84%35.0035.0045,683.58
EviscerateCombo Points68.80468.6564.22%6.816.81234,741.74
RuptureEnergy9.54238.582.66%25.0025.00147,050.23
RuptureCombo Points9.5465.248.94%6.846.84537,766.68
Secret TechniqueEnergy16.05481.625.37%30.0029.99169,276.77
Secret TechniqueCombo Points16.05104.9814.39%6.546.54776,560.94
ShadowstrikeEnergy52.402,358.1326.28%45.0045.0014,965.29
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.7029.87945.746.60.3100.0
Combo Points0.02.442.43100.63.80.07.0

Statistics & Data Analysis

Fight Length
Combo 1 Fight Length
Count 1214
Mean 300.42
Minimum 240.02
Maximum 359.88
Spread ( max - min ) 119.87
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
Combo 1 Damage Per Second
Count 1214
Mean 1464895.27
Minimum 1327655.71
Maximum 1658892.02
Spread ( max - min ) 331236.31
Range [ ( max - min ) / 2 * 100% ] 11.31%
Standard Deviation 50030.6344
5th Percentile 1381014.92
95th Percentile 1548295.09
( 95th Percentile - 5th Percentile ) 167280.17
Mean Distribution
Standard Deviation 1435.9082
95.00% Confidence Interval ( 1462080.95 - 1467709.60 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4481
0.1 Scale Factor Error with Delta=300 21367598
0.05 Scale Factor Error with Delta=300 85470389
0.01 Scale Factor Error with Delta=300 2136759724
Priority Target DPS
Combo 1 Priority Target Damage Per Second
Count 1214
Mean 1464895.27
Minimum 1327655.71
Maximum 1658892.02
Spread ( max - min ) 331236.31
Range [ ( max - min ) / 2 * 100% ] 11.31%
Standard Deviation 50030.6344
5th Percentile 1381014.92
95th Percentile 1548295.09
( 95th Percentile - 5th Percentile ) 167280.17
Mean Distribution
Standard Deviation 1435.9082
95.00% Confidence Interval ( 1462080.95 - 1467709.60 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4481
0.1 Scale Factor Error with Delta=300 21367598
0.05 Scale Factor Error with Delta=300 85470389
0.01 Scale Factor Error with Delta=300 2136759724
DPS(e)
Combo 1 Damage Per Second (Effective)
Count 1214
Mean 1464895.27
Minimum 1327655.71
Maximum 1658892.02
Spread ( max - min ) 331236.31
Range [ ( max - min ) / 2 * 100% ] 11.31%
Damage
Combo 1 Damage
Count 1214
Mean 439646690.25
Minimum 346820327.62
Maximum 539303771.03
Spread ( max - min ) 192483443.41
Range [ ( max - min ) / 2 * 100% ] 21.89%
DTPS
Combo 1 Damage Taken Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 1 Healing Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 1 Healing Per Second (Effective)
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 1 Heal
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 1 Healing Taken Per Second
Count 1214
Mean 3119.04
Minimum 0.00
Maximum 10704.60
Spread ( max - min ) 10704.60
Range [ ( max - min ) / 2 * 100% ] 171.60%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.40 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.53 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.49 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.31 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.66 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.71 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.05 secret_technique,if=variable.secret
L 9.54 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.31 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.80 eviscerate
actions.item
# count action,conditions
O 3.72 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.70 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.34 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.92 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNDNNDNHNDNQDFKDMNDNDNELHQDNKDNDDMENEENEEHNQDKDNDMDNEENEELHEKENEENEEMENEENEEENEEONEEJHQPKDIMDNNDNELHQNDFKNDNDMNEENEENENRDNEEHQKDNDNDDMELEEENEEKEEELEEEEMEEENEOEJHQPKDINDNNDMELHQDFKNDNNDNENENHQDKDMDNDNEENEENELEHQKDMDNDNDNEEENRDKEMEENEEELEENEOEJHQKPDINDMHNNDQNKDNNDNDMNEN

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, realigning_nexus_convergence_divergence
0:01.005Gpotion
[cds]
Fluffy_Pillow 69.1/100 69% energy
7.0/7 100% CP
bloodlust, flawless_form, the_first_dance, realigning_nexus_convergence_divergence
0:01.005Jflagellation
[cds]
Fluffy_Pillow 69.1/100 69% energy
7.0/7 100% CP
bloodlust, flawless_form, the_first_dance, realigning_nexus_convergence_divergence, tempered_potion
0:02.010Neviscerate
[finish]
Fluffy_Pillow 83.8/100 84% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes, flawless_form, the_first_dance, flagellation_buff, realigning_nexus_convergence_divergence, tempered_potion
0:03.014Rvanish
[stealth_cds]
Combo 1 98.6/100 99% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(3), alacrity, flawless_form, the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:03.014Dshadowstrike
[build]
Fluffy_Pillow 98.6/100 99% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(3), alacrity, flawless_form, premeditation, the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:04.018Lrupture
[finish]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(6), alacrity, flawless_form, shadow_techniques, the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.023Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(7), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(15), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.023Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(7), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(2), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.023Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(7), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.023Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(7), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.027Ishadow_blades
[cds]
Combo 1 69.8/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(9), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(2), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.027Ksecret_technique
[finish]
Fluffy_Pillow 69.8/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(9), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(2), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.031Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:08.038Neviscerate
[finish]
Fluffy_Pillow 69.2/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(4), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:09.043Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(3), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:10.048Neviscerate
[finish]
Fluffy_Pillow 77.3/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), flawless_form(4), shadow_techniques(10), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:11.055Neviscerate
[finish]
Fluffy_Pillow 99.8/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:12.060Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:13.063Neviscerate
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(7), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:14.067Hsymbols_of_death
[cds]
Combo 1 92.1/100 92% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:14.067Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:15.072Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(3), shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:16.075Neviscerate
[finish]
Fluffy_Pillow 69.6/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(3), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:17.080Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:17.080Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), premeditation, shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:18.085Fcold_blood
[cds]
Combo 1 69.6/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:18.085Ksecret_technique
[finish]
Fluffy_Pillow 69.6/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:19.090Dshadowstrike
[build]
Fluffy_Pillow 97.2/100 97% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:20.097Mcoup_de_grace
[finish]
Fluffy_Pillow 74.8/100 75% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(4), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:21.301Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:22.304Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:23.308Neviscerate
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:24.313Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:25.318Neviscerate
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:26.321Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:27.324Lrupture
[finish]
Fluffy_Pillow 83.3/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery, tempered_potion
0:28.330Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:28.330Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(7), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:28.330Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), premeditation, shadow_techniques(7), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:29.332Neviscerate
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(9), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:30.336Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:31.342Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:32.347Neviscerate
[finish]
Fluffy_Pillow 69.0/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:33.353Dshadowstrike
[build]
Fluffy_Pillow 91.1/100 91% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:34.359Dshadowstrike
[build]
Fluffy_Pillow 76.1/100 76% energy
5.0/7 71% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:35.364Mcoup_de_grace
[finish]
Fluffy_Pillow 53.2/100 53% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:36.569Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:37.573Neviscerate
[finish]
Fluffy_Pillow 82.0/100 82% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:38.577Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:39.584Ebackstab
[build]
Fluffy_Pillow 82.1/100 82% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:40.590Neviscerate
[finish]
Fluffy_Pillow 54.2/100 54% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:41.595Ebackstab
[build]
Fluffy_Pillow 73.0/100 73% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:42.600Ebackstab
[build]
Fluffy_Pillow 51.8/100 52% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:43.606Hsymbols_of_death
[cds]
Combo 1 30.6/100 31% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:43.606Neviscerate
[finish]
Fluffy_Pillow 70.6/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:44.611Qshadow_dance
[stealth_cds]
Combo 1 96.4/100 96% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:44.611Dshadowstrike
[build]
Fluffy_Pillow 96.4/100 96% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:45.615Ksecret_technique
[finish]
Fluffy_Pillow 62.2/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(7), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:46.620Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
0:47.624Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:48.629Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:49.633Mcoup_de_grace
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:50.837Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:51.843Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:52.848Ebackstab
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:53.850Ebackstab
[build]
Fluffy_Pillow 63.4/100 63% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:54.855Neviscerate
[finish]
Fluffy_Pillow 42.2/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:55.859Ebackstab
[build]
Fluffy_Pillow 56.0/100 56% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
0:57.438Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:58.530Lrupture
[finish]
Fluffy_Pillow 28.7/100 29% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery
0:59.534Hsymbols_of_death
[cds]
Combo 1 49.5/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery
0:59.534Ebackstab
[build]
Fluffy_Pillow 89.5/100 89% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(6), shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
1:00.539Ksecret_technique
[finish]
Fluffy_Pillow 68.3/100 68% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(6), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
1:01.619Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(6), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:02.623Neviscerate
[finish]
Fluffy_Pillow 78.8/100 79% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:03.629Ebackstab
[build]
Fluffy_Pillow 94.6/100 95% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:04.634Ebackstab
[build]
Fluffy_Pillow 73.4/100 73% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:05.639Neviscerate
[finish]
Fluffy_Pillow 52.2/100 52% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:06.644Ebackstab
[build]
Fluffy_Pillow 66.0/100 66% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
1:07.648Ebackstab
[build]
Fluffy_Pillow 45.4/100 45% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:09.675Mcoup_de_grace
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
1:10.880Ebackstab
[build]
Fluffy_Pillow 83.1/100 83% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_haste
1:11.884Neviscerate
[finish]
Fluffy_Pillow 62.5/100 63% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:12.890Ebackstab
[build]
Fluffy_Pillow 76.9/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:13.895Ebackstab
[build]
Fluffy_Pillow 56.3/100 56% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:15.260Neviscerate
[finish]
Fluffy_Pillow 35.8/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:16.264Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:18.911Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:21.723Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:24.442Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:25.448Ebackstab
[build]
Fluffy_Pillow 47.5/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:27.670Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:29.865Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 33.7/100 34% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:30.000Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, cryptic_instructions, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:31.006Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, cryptic_instructions, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:33.791Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
1:34.795Jflagellation
[cds]
Fluffy_Pillow 16.7/100 17% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
1:35.800Hsymbols_of_death
[cds]
Combo 1 28.1/100 28% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flagellation_buff, deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
1:35.800Qshadow_dance
[stealth_cds]
Combo 1 68.1/100 68% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(3), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_haste
1:35.800Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 68.1/100 68% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(3), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_haste
1:35.800Ksecret_technique
[finish]
Fluffy_Pillow 68.1/100 68% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(3), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:36.806Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:37.812Ishadow_blades
[cds]
Combo 1 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(5), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:37.812Mcoup_de_grace
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(5), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:39.016Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:40.021Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(9), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:41.027Neviscerate
[finish]
Fluffy_Pillow 85.8/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:42.033Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:43.037Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:44.043Ebackstab
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:45.050Lrupture
[finish]
Fluffy_Pillow 73.3/100 73% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(10), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:46.053Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:46.053Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:46.053Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:47.058Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(7), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:48.061Fcold_blood
[cds]
Combo 1 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:48.061Ksecret_technique
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:49.065Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:50.068Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:51.071Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:52.077Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:53.081Mcoup_de_grace
[finish]
Fluffy_Pillow 60.2/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:54.284Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:55.288Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:56.294Ebackstab
[build]
Fluffy_Pillow 79.4/100 79% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:57.299Neviscerate
[finish]
Fluffy_Pillow 58.8/100 59% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:58.305Ebackstab
[build]
Fluffy_Pillow 78.5/100 78% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:59.310Ebackstab
[build]
Fluffy_Pillow 58.1/100 58% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:00.315Neviscerate
[finish]
Fluffy_Pillow 45.8/100 46% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:01.322Ebackstab
[build]
Fluffy_Pillow 65.4/100 65% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(7), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:02.325Neviscerate
[finish]
Fluffy_Pillow 37.0/100 37% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:03.330Rvanish
[stealth_cds]
Combo 1 52.7/100 53% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:03.330Dshadowstrike
[build]
Fluffy_Pillow 52.7/100 53% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), premeditation, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:05.486Neviscerate
[finish]
Fluffy_Pillow 36.6/100 37% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:06.490Ebackstab
[build]
Fluffy_Pillow 48.3/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:08.696Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
2:09.956Hsymbols_of_death
[cds]
Combo 1 14.4/100 14% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
2:10.024Qshadow_dance
[stealth_cds]
Combo 1 55.1/100 55% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
2:10.024Ksecret_technique
[finish]
Fluffy_Pillow 55.1/100 55% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
2:11.027Dshadowstrike
[build]
Fluffy_Pillow 94.1/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
2:12.032Neviscerate
[finish]
Fluffy_Pillow 60.1/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
2:13.038Dshadowstrike
[build]
Fluffy_Pillow 94.0/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
2:14.043Neviscerate
[finish]
Fluffy_Pillow 67.8/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
2:15.047Dshadowstrike
[build]
Fluffy_Pillow 78.6/100 79% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
2:16.053Dshadowstrike
[build]
Fluffy_Pillow 52.4/100 52% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
2:17.950Mcoup_de_grace
[finish]
Fluffy_Pillow 35.8/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
2:19.155Ebackstab
[build]
Fluffy_Pillow 81.8/100 82% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:20.159Lrupture
[finish]
Fluffy_Pillow 52.5/100 53% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), deeper_daggers, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:21.166Ebackstab
[build]
Fluffy_Pillow 73.4/100 73% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), deeper_daggers, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:22.168Ebackstab
[build]
Fluffy_Pillow 52.1/100 52% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:24.119Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:26.556Neviscerate
[finish]
Fluffy_Pillow 35.3/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:27.560Ebackstab
[build]
Fluffy_Pillow 50.1/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:30.032Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:32.207Ksecret_technique
[finish]
Fluffy_Pillow 32.0/100 32% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:33.211Ebackstab
[build]
Fluffy_Pillow 42.8/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
2:36.405Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_mastery
2:39.774Ebackstab
[build]
Fluffy_Pillow 41.5/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_mastery
2:42.575Lrupture
[finish]
Fluffy_Pillow 39.7/100 40% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), flask_of_alchemical_chaos_mastery
2:43.580Ebackstab
[build]
Fluffy_Pillow 60.6/100 61% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), flask_of_alchemical_chaos_mastery
2:45.129Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_mastery
2:48.443Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, flask_of_alchemical_chaos_mastery
2:51.432Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), flask_of_alchemical_chaos_mastery
2:54.301Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(3), flask_of_alchemical_chaos_mastery
2:55.506Ebackstab
[build]
Fluffy_Pillow 74.3/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
2:56.511Ebackstab
[build]
Fluffy_Pillow 45.1/100 45% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), deeper_daggers, flask_of_alchemical_chaos_mastery
2:59.116Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
3:01.511Neviscerate
[finish]
Fluffy_Pillow 35.1/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
3:02.515Ebackstab
[build]
Fluffy_Pillow 45.9/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
3:03.519Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 20.8/100 21% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
3:05.030Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
3:06.034Jflagellation
[cds]
Fluffy_Pillow 15.9/100 16% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
3:07.039Hsymbols_of_death
[cds]
Combo 1 27.0/100 27% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, flagellation_buff, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
3:07.039Qshadow_dance
[stealth_cds]
Combo 1 67.0/100 67% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
3:07.039Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 67.0/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
3:07.039Ksecret_technique
[finish]
Fluffy_Pillow 67.0/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:08.044Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(11), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:09.049Ishadow_blades
[cds]
Combo 1 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(11), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:09.049Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(11), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:10.054Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:11.059Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(7), flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:12.063Neviscerate
[finish]
Fluffy_Pillow 85.8/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), flagellation_buff(28), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:13.067Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:14.071Mcoup_de_grace
[finish]
Fluffy_Pillow 74.9/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:15.276Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:16.279Lrupture
[finish]
Fluffy_Pillow 79.9/100 80% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:17.283Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:17.283Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(8), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:17.283Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), premeditation, shadow_techniques(8), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:18.288Fcold_blood
[cds]
Combo 1 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:18.288Ksecret_technique
[finish]
Fluffy_Pillow 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:19.291Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(10), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:20.297Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:21.300Neviscerate
[finish]
Fluffy_Pillow 74.9/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:22.304Neviscerate
[finish]
Fluffy_Pillow 86.9/100 87% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:23.308Dshadowstrike
[build]
Fluffy_Pillow 98.8/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:24.312Neviscerate
[finish]
Fluffy_Pillow 81.8/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:25.317Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(10), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:26.322Neviscerate
[finish]
Fluffy_Pillow 72.0/100 72% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:27.325Ebackstab
[build]
Fluffy_Pillow 91.9/100 92% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:28.331Neviscerate
[finish]
Fluffy_Pillow 71.9/100 72% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:29.334Hsymbols_of_death
[cds]
Combo 1 83.8/100 84% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:29.334Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:29.334Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:30.339Ksecret_technique
[finish]
Fluffy_Pillow 67.0/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:31.344Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:32.349Mcoup_de_grace
[finish]
Fluffy_Pillow 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:33.553Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:34.559Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:35.564Dshadowstrike
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:36.570Neviscerate
[finish]
Fluffy_Pillow 60.3/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:37.576Ebackstab
[build]
Fluffy_Pillow 71.1/100 71% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_crit
3:38.581Ebackstab
[build]
Fluffy_Pillow 57.9/100 58% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:39.586Neviscerate
[finish]
Fluffy_Pillow 36.7/100 37% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:40.592Ebackstab
[build]
Fluffy_Pillow 50.5/100 51% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:42.625Ebackstab
[build]
Fluffy_Pillow 40.4/100 40% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:44.728Neviscerate
[finish]
Fluffy_Pillow 39.0/100 39% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
3:45.733Ebackstab
[build]
Fluffy_Pillow 57.8/100 58% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(7), deeper_daggers, flask_of_alchemical_chaos_crit
3:46.737Lrupture
[finish]
Fluffy_Pillow 28.6/100 29% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
3:47.742Ebackstab
[build]
Fluffy_Pillow 53.4/100 53% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:49.887Hsymbols_of_death
[cds]
Combo 1 40.4/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
3:50.024Qshadow_dance
[stealth_cds]
Combo 1 81.9/100 82% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
3:50.024Ksecret_technique
[finish]
Fluffy_Pillow 81.9/100 82% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
3:51.029Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
3:52.034Mcoup_de_grace
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(3), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:53.238Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:54.242Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:55.246Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:56.251Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:57.255Dshadowstrike
[build]
Fluffy_Pillow 85.2/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
3:58.260Neviscerate
[finish]
Fluffy_Pillow 51.0/100 51% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
3:59.264Ebackstab
[build]
Fluffy_Pillow 61.8/100 62% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
4:00.268Ebackstab
[build]
Fluffy_Pillow 40.5/100 41% energy
2.0/7 29% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:02.556Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:05.080Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(5), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:06.084Rvanish
[stealth_cds]
Combo 1 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(6), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:06.084Dshadowstrike
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, premeditation, shadow_techniques(6), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:08.268Ksecret_technique
[finish]
Fluffy_Pillow 33.6/100 34% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(7), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:09.272Ebackstab
[build]
Fluffy_Pillow 49.4/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(7), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:11.380Mcoup_de_grace
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:12.584Ebackstab
[build]
Fluffy_Pillow 78.2/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:13.588Ebackstab
[build]
Fluffy_Pillow 53.0/100 53% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:15.375Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:16.381Ebackstab
[build]
Fluffy_Pillow 42.2/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:19.225Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:22.205Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
4:24.172Lrupture
[finish]
Fluffy_Pillow 26.2/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), flask_of_alchemical_chaos_vers
4:25.179Ebackstab
[build]
Fluffy_Pillow 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(3), flask_of_alchemical_chaos_vers
4:27.504Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, flask_of_alchemical_chaos_vers
4:30.475Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, flask_of_alchemical_chaos_vers
4:31.479Ebackstab
[build]
Fluffy_Pillow 42.1/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
4:34.342Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 41.0/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
4:34.342Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_vers
4:35.886Jflagellation
[cds]
Fluffy_Pillow 21.7/100 22% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_vers
4:37.037Hsymbols_of_death
[cds]
Combo 1 38.5/100 39% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), flagellation_buff, deeper_daggers, stormbringers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
4:37.037Qshadow_dance
[stealth_cds]
Combo 1 78.5/100 79% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
4:37.037Ksecret_technique
[finish]
Fluffy_Pillow 78.5/100 79% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
4:38.043Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
4:38.043Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:39.047Ishadow_blades
[cds]
Combo 1 82.6/100 83% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(9), bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:39.049Neviscerate
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(9), bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:40.053Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(10), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:41.059Mcoup_de_grace
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(12), flagellation_buff(19), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:42.264Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(9), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:42.264Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(9), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:43.268Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(2), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:44.272Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:45.277Qshadow_dance
[stealth_cds]
Combo 1 82.6/100 83% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(8), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:45.277Neviscerate
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), premeditation, shadow_techniques(8), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:46.281Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), premeditation, shadow_techniques(3), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:47.284Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(10), premeditation, shadow_techniques(5), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:48.289Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(11), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:49.293Neviscerate
[finish]
Fluffy_Pillow 94.3/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:50.297Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:51.300Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:52.303Dshadowstrike
[build]
Fluffy_Pillow 93.9/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:53.309Mcoup_de_grace
[finish]
Fluffy_Pillow 68.4/100 68% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(10), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:54.513Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(5), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:55.518Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(7), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:56.523Neviscerate
[finish]
Fluffy_Pillow 79.4/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit16.54%16.97%3476
Haste2.35%2.79%1843
Versatility29.74%22.21%17321
Attack Power6162857457938
Mastery66.00%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 1"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 2 : 1,447,811 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,447,811.01,447,811.02,757.0 / 0.190%183,535.0 / 12.7%48,432.0
Resource Out In Waiting APM Active
Energy29.929.711.67%57.1100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 21,447,811
Auto Attack 0 (71,781)0.0% (5.0%)3.9122.13s5,476,5230

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 47,9443.3%355.30.99s40,50941,411Direct355.338,06976,72240,51722.4%16.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage355.31355.310.000.000.000.97820.000014,392,972.2018,764,556.6723.30%41,410.7641,410.76
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit61.30%217.8015729838,068.8722,79664,62438,081.7336,37340,3088,291,05810,810,02923.30%
crit22.38%79.534612876,722.3146,112129,44276,764.6669,21884,9406,101,9157,954,52823.29%
miss16.32%57.9828850.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,8371.6%354.40.99s20,19320,574Direct354.418,97138,22320,19422.5%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage354.42354.420.000.000.000.98140.00007,156,738.849,330,186.3323.29%20,574.4520,574.45
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit61.16%216.7715428218,970.9311,34132,18018,977.8317,64020,0074,112,2625,361,55923.30%
crit22.48%79.674312138,223.0822,94164,45738,242.3634,91542,1243,044,4773,968,62823.29%
miss16.36%57.9835880.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,8882.1%75.53.67s123,033122,482Direct75.572,380186,712123,01344.3%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.5075.500.000.000.001.00450.00009,289,177.7812,140,055.0123.48%122,482.27122,482.27
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.70%42.06206272,379.6556,630157,64772,383.9668,00576,9983,044,1543,979,65223.50%
crit44.30%33.441852186,711.83124,790410,228186,826.23172,097205,4196,245,0238,160,40323.49%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.49

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 87,924 (125,528)6.1% (8.7%)13.322.22s2,832,3972,351,612Direct39.8 (78.3)499,2881,002,262662,40632.4% (32.5%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.3039.820.000.000.001.20450.000026,380,525.5034,341,362.7423.18%2,351,611.982,351,611.98
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.57%26.911342499,287.79108,9411,886,909499,605.99345,377675,04913,433,65217,487,77423.19%
crit32.43%12.914251,002,262.14227,6373,660,4241,003,789.37403,8361,670,73912,946,87316,853,58923.19%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.30
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 37,6042.6%0.00.00s00Direct38.5221,549442,488293,28232.5%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.460.000.000.000.00000.000011,282,892.0011,282,892.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.49%25.951440221,549.0051,937792,822221,996.26141,507322,1335,751,1915,751,1910.00%
crit32.51%12.50324442,488.12108,5241,639,672442,235.57191,571738,0475,531,7015,531,7010.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (19,885)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 19,8851.4%22.412.99s267,1380Direct22.4267,2170267,2170.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.3622.350.000.000.000.00000.00005,972,968.365,972,968.360.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.351041267,217.06258,255312,421267,200.26260,430277,5545,972,9685,972,9680.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 251,833 (359,935)17.4% (24.9%)68.74.40s1,570,9221,563,892Direct68.7 (136.5)821,8681,677,6581,099,32732.4% (32.1%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.7468.740.000.000.001.00450.000075,550,613.3198,266,542.1623.12%1,563,892.311,563,892.31
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.57%46.452969821,867.87200,1282,437,568821,781.29672,475970,93138,173,46349,652,83223.12%
crit32.43%22.307381,677,658.50400,8574,809,4781,676,290.661,152,7422,194,47237,377,15048,613,71023.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.75

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 108,1027.5%67.74.46s479,0500Direct67.7360,398733,595479,22531.8%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.7267.720.000.000.000.00000.000032,439,278.6232,439,278.620.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit68.18%46.172766360,398.4395,4101,057,504360,400.41296,009434,51016,633,95516,633,9550.00%
crit31.82%21.55935733,595.39191,1062,086,523733,218.21480,6461,021,79515,805,32315,805,3230.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,050 (21,325)0.1% (1.5%)3.791.35s1,724,5371,717,138Direct3.7 (27.6)69,185138,43284,78822.5% (22.9%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000314,987.22314,987.220.00%1,717,137.801,717,137.80
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.49%2.880469,185.1460,382133,46268,762.680107,206199,228199,2280.00%
crit22.51%0.8404138,432.36120,945252,44083,993.660241,154115,760115,7600.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 20,2751.4%0.00.00s00Direct23.9207,845414,442255,25322.9%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.870.000.000.000.00000.00006,091,653.896,091,653.890.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.07%18.40927207,845.2978,907435,467207,729.46172,716245,3333,823,7403,823,7400.00%
crit22.93%5.47014414,441.87160,330895,557411,090.590790,4982,267,9142,267,9140.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,4330.9%0.00.00s00Direct284.310,69721,54513,13122.4%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00284.320.000.000.000.00000.00003,733,040.203,733,040.200.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.57%220.5415331110,696.547,44717,64010,698.6310,05711,2732,358,7802,358,7800.00%
crit22.43%63.78319821,544.7114,91734,87021,560.7019,67024,3731,374,2601,374,2600.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 96,675 (114,453)6.7% (7.9%)9.531.38s3,598,5443,582,635Periodic167.6 (335.2)129,778268,196173,19831.4% (31.3%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.550.00167.58167.587.091.00451.741329,025,290.4829,025,290.480.00%114,004.453,582,635.27
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit68.63%115.0180152129,778.14155426,678129,811.83115,521151,05514,923,28714,923,2870.00%
crit31.37%52.582879268,195.87444823,191268,458.78188,330331,37314,102,00314,102,0030.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.55
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 17,7771.2%167.61.77s31,8390Periodic167.623,86249,35831,84231.3%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.580.000.00167.580.000.00000.00005,335,764.425,335,764.420.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit68.70%115.137615623,861.869,17978,23623,871.4020,30326,8892,747,0482,747,0480.00%
crit31.30%52.45298049,357.8118,385146,13549,430.2438,22763,1532,588,7172,588,7170.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (263,661)0.0% (18.2%)16.118.93s4,927,0004,905,155

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.060.000.000.000.001.00450.00000.000.000.00%4,905,154.924,905,154.92

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.06
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 67,7124.7%0.00.00s00Direct16.1655,9151,981,6341,265,67746.0%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.060.000.000.000.00000.000020,316,453.4926,468,283.8823.24%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit54.00%8.67314655,914.82143,8801,568,487656,588.86428,900919,7655,688,3367,426,35923.41%
crit46.00%7.393141,981,634.38287,2024,088,3812,018,563.761,152,8413,150,42914,628,11719,041,92523.17%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 195,94913.5%0.00.00s00Direct32.0946,0562,863,2721,838,01546.5%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0032.020.000.000.000.00000.000058,803,695.3658,803,695.360.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit53.55%17.14627946,055.80210,3392,338,730947,154.88581,7841,246,98516,214,29116,214,2910.00%
crit46.45%14.877262,863,272.07421,3095,912,2852,889,319.831,888,2754,179,54742,589,40442,589,4040.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (103,319)0.0% (7.1%)3.790.91s8,496,5130

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.65
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 103,3197.1%385.21.20s80,5240Periodic385.280,528080,5280.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage385.210.000.00385.210.000.00000.000031,018,572.9031,018,572.900.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%385.2128246780,528.43921,090,79080,579.0767,70596,12831,018,57331,018,5730.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6910.12
  • base_dd_max:6910.12
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 117,8518.1%52.45.89s673,676670,677Direct52.4278,338903,745673,78363.2%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.4452.440.000.000.001.00450.000035,325,247.8146,038,269.2623.27%670,677.37670,677.37
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit36.78%19.29931278,338.35129,100420,052278,383.72250,541313,1195,368,3346,993,72723.24%
crit63.22%33.152146903,745.43284,4851,420,226904,371.36831,802972,82729,956,91439,044,54223.28%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.44

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,7070.3%2.374.23s475,1550Direct2.3389,480776,520475,32422.2%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.352.340.000.000.000.00000.00001,114,304.101,114,304.100.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.83%1.8207389,480.38366,167460,066329,125.840458,091710,649710,6490.00%
crit22.17%0.5204776,519.74733,432925,614318,103.540925,614403,655403,6550.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8380.1%2.370.69s108,0710Direct2.387,994177,327108,05822.4%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.332.330.000.000.000.00000.0000251,839.01251,839.010.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.55%1.810887,994.2680,745113,41473,933.710111,565159,037159,0370.00%
crit22.45%0.5204177,326.91161,733220,25071,410.350220,25092,80292,8020.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67764.07
  • base_dd_max:67764.07
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 46,7133.2%19.214.70s732,0340Periodic107.3130,8580130,8580.0%0.0%71.5%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.180.00107.34107.3412.220.00002.000014,038,293.0514,038,293.050.00%65,392.630.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.3463152130,858.2560,451222,172129,898.0776,418172,60014,038,29314,038,2930.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 64,1284.4%32.68.80s591,5220Direct32.6484,057970,474591,66422.1%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage32.5632.560.000.000.000.00000.000019,261,006.8919,261,006.890.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.91%25.371043484,057.30439,580827,427483,813.15450,714529,49612,278,02112,278,0210.00%
crit22.09%7.19019970,473.95880,4791,623,465969,508.8201,203,9296,982,9866,982,9860.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,5490.3%2.471.42s578,3980Direct2.4467,016937,169578,35523.7%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.362.360.000.000.000.00000.00001,367,859.271,367,859.270.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit76.31%1.8008467,016.07439,132560,181391,370.860557,738842,976842,9760.00%
crit23.69%0.5604937,169.30879,5821,094,283402,154.5901,094,283524,883524,8830.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 86,8166.0%58.35.12s447,1550Direct58.3364,460733,047447,17422.4%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.2558.250.000.000.000.00000.000026,048,811.0134,005,162.8923.40%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.56%45.182863364,459.55218,860569,682364,646.79336,649397,00516,464,94121,495,77623.41%
crit22.44%13.07423733,046.62438,3761,109,510733,730.35586,655894,2129,583,87012,509,38723.39%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 2
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.74s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.560.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.45s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.730.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.411.74s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.420.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.476.51s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.410.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.373.44s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.280.0053.520.000.230.00000.83410.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5310.67s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.490.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.48
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 99.03.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.970.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.372.96s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.340.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.29s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.320.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.32
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.370.69s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.332.330.000.000.000.00000.00000.001,553,433.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.33090.00000.000001,553,43390.36%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8380.1%2.370.69s108,0710Direct2.387,994177,327108,05822.4%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.332.330.000.000.000.00000.0000251,839.01251,839.010.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.55%1.810887,994.2680,745113,41473,933.710111,565159,037159,0370.00%
crit22.45%0.5204177,326.91161,733220,25071,410.350220,25092,80292,8020.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67764.07
  • base_dd_max:67764.07
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.321.45s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.310.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.31
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.13s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.94
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.374.41s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.290.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1592.7158.8s0.5s278.0s99.94%100.00%583.0 (583.0)0.1

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:3.6s / 330.1s
  • trigger_min/max:0.0s / 4.0s
  • trigger_pct:100.00%
  • duration_min/max:1.1s / 359.9s
  • uptime_min/max:99.20% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.20%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.33%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.282.9117.7s3.5s131.1s97.39%0.00%74.8 (77.7)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 338.8s
  • trigger_min/max:1.0s / 38.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.8s
  • uptime_min/max:86.73% / 99.44%

Stack Uptimes

  • alacrity_1:2.90%
  • alacrity_2:2.10%
  • alacrity_3:1.74%
  • alacrity_4:1.58%
  • alacrity_5:89.06%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.50%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.10.018.9s18.9s6.9s37.03%100.00%0.0 (0.0)15.7

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 55.9s
  • trigger_min/max:9.2s / 55.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:32.13% / 40.70%

Stack Uptimes

  • bolstering_shadows_1:37.03%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.1s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:84.0s / 183.0s
  • trigger_min/max:84.0s / 183.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.06%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.20.0129.4s107.2s4.4s1.82%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.7s
  • trigger_min/max:90.0s / 187.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.2s
  • uptime_min/max:0.00% / 7.12%

Stack Uptimes

  • cryptic_instructions_1:1.82%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.348.123.1s23.1s8.2s36.45%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 68.6s
  • trigger_min/max:8.0s / 68.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.71% / 39.21%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.54%
  • danse_macabre_3:6.59%
  • danse_macabre_4:16.44%
  • danse_macabre_5:8.83%
  • danse_macabre_6:0.02%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.440.9s3.7s35.6s90.14%95.71%74.4 (74.4)6.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 172.3s
  • trigger_min/max:1.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 158.9s
  • uptime_min/max:77.24% / 96.01%

Stack Uptimes

  • deeper_daggers_1:90.14%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.10.018.9s18.9s3.4s18.37%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 55.9s
  • trigger_min/max:9.2s / 55.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.04% / 20.85%

Stack Uptimes

  • disorienting_strikes_1:12.20%
  • disorienting_strikes_2:6.16%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.30.0128.4s108.0s4.0s1.69%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.7s
  • trigger_min/max:90.0s / 188.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.4s
  • uptime_min/max:0.00% / 7.74%

Stack Uptimes

  • errant_manaforge_emission_1:1.69%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.144.122.1s5.2s17.4s81.63%0.00%3.2 (3.2)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 63.7s
  • trigger_min/max:1.0s / 25.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 59.5s
  • uptime_min/max:65.50% / 92.95%

Stack Uptimes

  • escalating_blade_1:25.03%
  • escalating_blade_2:22.01%
  • escalating_blade_3:22.56%
  • escalating_blade_4:12.03%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.7s90.7s14.7s18.17%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:82.6s / 182.5s
  • trigger_min/max:82.6s / 182.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s
  • uptime_min/max:12.87% / 20.89%

Stack Uptimes

  • ethereal_powerlink_1:18.17%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.283.6s72.4s15.3s10.48%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4307.62

Trigger Details

  • interval_min/max:15.1s / 300.3s
  • trigger_min/max:1.0s / 300.3s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 42.9s
  • uptime_min/max:0.00% / 37.86%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.48%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.8s14.63%0.00%14.3 (96.2)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.0s
  • trigger_min/max:1.0s / 91.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:13.01% / 16.94%

Stack Uptimes

  • flagellation_buff_1:1.30%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.76%
  • flagellation_buff_9:0.62%
  • flagellation_buff_10:0.56%
  • flagellation_buff_11:0.46%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.01%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.04%
  • flagellation_buff_19:0.42%
  • flagellation_buff_20:0.40%
  • flagellation_buff_21:0.30%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.22%
  • flagellation_buff_25:0.85%
  • flagellation_buff_26:0.36%
  • flagellation_buff_27:0.20%
  • flagellation_buff_28:0.20%
  • flagellation_buff_29:0.00%
  • flagellation_buff_30:7.10%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.19%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.1s / 98.0s
  • trigger_min/max:78.1s / 98.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 12.0s
  • uptime_min/max:12.40% / 16.22%

Stack Uptimes

  • flagellation_persist_8:0.00%
  • flagellation_persist_30:14.19%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.20.6110.0s75.4s35.2s25.62%0.00%3.0 (3.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 337.3s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 150.0s
  • uptime_min/max:0.00% / 69.94%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.62%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6112.8s79.3s34.6s24.20%0.00%2.7 (2.7)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.8s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 210.0s
  • uptime_min/max:0.00% / 78.63%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.20%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.7111.5s75.1s36.1s25.42%0.00%3.0 (3.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 352.1s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 77.89%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.42%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6113.0s78.2s35.2s24.76%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 180.0s
  • uptime_min/max:0.00% / 77.44%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.76%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.60.040.7s3.4s60.0s95.42%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.48%
  • flawless_form_2:8.89%
  • flawless_form_3:11.90%
  • flawless_form_4:9.73%
  • flawless_form_5:2.66%
  • flawless_form_6:4.39%
  • flawless_form_7:6.02%
  • flawless_form_8:11.33%
  • flawless_form_9:18.50%
  • flawless_form_10:8.78%
  • flawless_form_11:1.39%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.01%
  • flawless_form_15:0.16%
  • flawless_form_16:0.09%
  • flawless_form_17:0.01%
  • flawless_form_18:0.01%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.285.1s72.2s16.8s10.86%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.1s / 301.1s
  • trigger_min/max:0.4s / 301.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.6s
  • uptime_min/max:0.00% / 37.49%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.86%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.285.4s70.9s17.0s10.97%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:2.3s / 294.7s
  • trigger_min/max:0.1s / 294.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 49.6s
  • uptime_min/max:0.00% / 42.77%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.98%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.286.7s72.5s16.8s10.54%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.8s / 288.8s
  • trigger_min/max:0.1s / 288.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.2s
  • uptime_min/max:0.00% / 44.27%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.54%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.286.9s73.0s16.9s10.86%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.4s / 323.0s
  • trigger_min/max:0.3s / 312.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 60.1s
  • uptime_min/max:0.00% / 46.02%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.86%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.90.422.1s21.3s3.7s17.08%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 84.3s
  • trigger_min/max:1.0s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.0s
  • uptime_min/max:9.37% / 26.28%

Stack Uptimes

  • poised_shadows_1:17.08%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.30.017.9s18.9s1.1s2.65%11.21%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 66.2s
  • trigger_min/max:1.0s / 66.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.70% / 4.51%

Stack Uptimes

  • premeditation_1:2.65%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0125.2s110.4s4.0s1.61%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.7s
  • trigger_min/max:90.0s / 248.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 10.0s
  • uptime_min/max:0.00% / 6.35%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.61%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.10.282.9s69.8s15.5s10.78%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:23422.66

Trigger Details

  • interval_min/max:15.1s / 306.3s
  • trigger_min/max:0.9s / 306.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.5s
  • uptime_min/max:0.00% / 39.65%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.78%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.70.090.9s90.9s15.8s19.17%17.14%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.7s
  • trigger_min/max:90.0s / 97.7s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 16.0s
  • uptime_min/max:16.89% / 21.90%

Stack Uptimes

  • shadow_blades_1:19.17%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.1s23.1s8.2s36.45%100.00%0.0 (0.0)13.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 68.6s
  • trigger_min/max:8.0s / 68.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.71% / 39.21%

Stack Uptimes

  • shadow_dance_1:36.45%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.0139.04.4s1.4s3.5s79.18%95.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 52.8s
  • trigger_min/max:0.5s / 6.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.4s
  • uptime_min/max:71.78% / 85.49%

Stack Uptimes

  • shadow_techniques_1:20.45%
  • shadow_techniques_2:20.94%
  • shadow_techniques_3:9.35%
  • shadow_techniques_4:10.54%
  • shadow_techniques_5:6.05%
  • shadow_techniques_6:5.90%
  • shadow_techniques_7:2.57%
  • shadow_techniques_8:2.37%
  • shadow_techniques_9:0.52%
  • shadow_techniques_10:0.44%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.01%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s298.4s99.32%87.44%99.0 (99.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.0s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.50.0106.0s95.4s9.9s1.80%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:12.2s / 331.0s
  • trigger_min/max:1.0s / 291.5s
  • trigger_pct:100.00%
  • duration_min/max:1.1s / 19.8s
  • uptime_min/max:0.00% / 15.34%

Stack Uptimes

  • storm_sewers_citrine_1:1.80%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.0117.8s111.4s9.9s1.84%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.2s / 303.6s
  • trigger_min/max:3.8s / 303.6s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 24.6s
  • uptime_min/max:0.00% / 15.48%

Stack Uptimes

  • storm_sewers_citrine_1:1.84%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.0118.3s107.9s9.8s1.99%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.1s / 337.6s
  • trigger_min/max:1.0s / 337.6s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 22.6s
  • uptime_min/max:0.00% / 13.42%

Stack Uptimes

  • storm_sewers_citrine_1:1.99%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.00.283.3s70.6s15.5s10.38%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1346.13
  • stat:haste_rating
  • amount:1346.13
  • stat:mastery_rating
  • amount:1346.13
  • stat:versatility_rating
  • amount:1346.13

Trigger Details

  • interval_min/max:15.0s / 322.5s
  • trigger_min/max:0.3s / 322.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 43.1s
  • uptime_min/max:0.00% / 38.58%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.38%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.4s21.4s2.3s10.99%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 68.2s
  • trigger_min/max:3.0s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.2s
  • uptime_min/max:9.13% / 17.31%

Stack Uptimes

  • supercharge_1_1:10.99%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.03%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 68.2s
  • trigger_min/max:2.0s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.2s
  • uptime_min/max:0.58% / 8.64%

Stack Uptimes

  • supercharge_2_1:2.03%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s2.6s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.4s
  • uptime_min/max:0.00% / 2.55%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s4.5s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:2.8s / 6.2s
  • uptime_min/max:0.00% / 2.13%

Stack Uptimes

  • supercharge_4_1:0.01%

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.56.843.3s21.3s24.4s61.12%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.1s / 98.0s
  • trigger_min/max:1.0s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.0s
  • uptime_min/max:57.31% / 65.19%

Stack Uptimes

  • symbols_of_death_1:61.12%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.8s307.8s27.7s13.43%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.4s
  • trigger_min/max:300.0s / 329.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 30.0s
  • uptime_min/max:9.94% / 18.08%

Stack Uptimes

  • tempered_potion_1:13.43%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.69%3.80%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.40% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.69%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.4s21.3s2.9s13.78%22.29%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 68.2s
  • trigger_min/max:1.0s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.6s
  • uptime_min/max:11.23% / 16.48%

Stack Uptimes

  • the_rotten_1:10.72%
  • the_rotten_2:3.06%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.2s
  • trigger_min/max:120.0s / 136.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.37%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.0133.2s56.1s15.2s0.49%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4461.95

Trigger Details

  • interval_min/max:46.6s / 230.5s
  • trigger_min/max:1.7s / 230.5s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 29.7s
  • uptime_min/max:0.00% / 12.06%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.52%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.00.287.6s74.4s15.3s10.12%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5555.09

Trigger Details

  • interval_min/max:15.1s / 326.2s
  • trigger_min/max:0.3s / 326.2s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 52.2s
  • uptime_min/max:0.00% / 31.34%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.13%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.826.081.05.9s0.7s67.9s
Skyfury (Off Hand)49.428.075.06.0s0.7s63.1s
Supercharger secret_technique12.48.016.023.6s9.2s89.6s
Cold Blood secret_technique3.63.04.090.7s84.0s183.0s
Supercharger rupture0.20.03.0178.8s75.1s273.3s
Supercharger coup_de_grace2.80.09.076.7s8.2s319.0s
Supercharger eviscerate13.07.020.023.1s1.0s143.8s
CP Spent During Flagellation202.2116.0248.011.2s1.0s92.7s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.40%5.65%13.08%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 2
Energy RegenEnergy1,438.903,039.9134.09%2.11399.6511.62%
Improved AmbushCombo Points52.4433.714.60%0.6418.7335.71%
PremeditationCombo Points17.2457.127.79%3.3163.5752.67%
Relentless StrikesEnergy107.664,283.5948.03%39.79123.462.80%
Shadow BladesCombo Points21.95114.0215.55%5.2017.6513.41%
Shadow TechniquesEnergy360.261,235.4213.85%3.43205.6314.27%
Shadow TechniquesCombo Points85.71241.5132.93%2.820.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.30107.0814.60%7.000.000.00%
BackstabCombo Points75.4975.1010.24%0.990.380.51%
ShadowstrikeCombo Points52.44104.8414.30%2.000.030.03%
Symbols of DeathEnergy14.30359.094.03%25.10213.0837.24%
Usage Type Count Total Tot% Avg RPE APR
Combo 2
BackstabEnergy75.493,019.5833.66%40.0039.993,076.32
Coup de GraceEnergy13.30465.455.19%35.0035.0080,918.53
Coup de GraceCombo Points13.3090.8712.46%6.836.83414,478.12
EviscerateEnergy68.752,406.3226.82%35.0035.0044,877.59
EviscerateCombo Points68.75468.2964.20%6.816.81230,606.96
RuptureEnergy9.55238.722.66%25.0025.00143,936.63
RuptureCombo Points9.5565.348.96%6.846.84525,919.19
Secret TechniqueEnergy16.06481.745.37%30.0030.00164,239.18
Secret TechniqueCombo Points16.06104.9214.38%6.536.53754,134.49
ShadowstrikeEnergy52.442,359.6026.30%45.0045.0014,970.86
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.6929.86941.346.70.3100.0
Combo Points0.02.442.43100.34.00.07.0

Statistics & Data Analysis

Fight Length
Combo 2 Fight Length
Count 1214
Mean 300.42
Minimum 240.02
Maximum 359.88
Spread ( max - min ) 119.87
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
Combo 2 Damage Per Second
Count 1214
Mean 1447811.00
Minimum 1301411.61
Maximum 1605704.74
Spread ( max - min ) 304293.13
Range [ ( max - min ) / 2 * 100% ] 10.51%
Standard Deviation 49011.8923
5th Percentile 1368643.23
95th Percentile 1531103.96
( 95th Percentile - 5th Percentile ) 162460.73
Mean Distribution
Standard Deviation 1406.6697
95.00% Confidence Interval ( 1445053.97 - 1450568.02 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4403
0.1 Scale Factor Error with Delta=300 20506268
0.05 Scale Factor Error with Delta=300 82025069
0.01 Scale Factor Error with Delta=300 2050626712
Priority Target DPS
Combo 2 Priority Target Damage Per Second
Count 1214
Mean 1447811.00
Minimum 1301411.61
Maximum 1605704.74
Spread ( max - min ) 304293.13
Range [ ( max - min ) / 2 * 100% ] 10.51%
Standard Deviation 49011.8923
5th Percentile 1368643.23
95th Percentile 1531103.96
( 95th Percentile - 5th Percentile ) 162460.73
Mean Distribution
Standard Deviation 1406.6697
95.00% Confidence Interval ( 1445053.97 - 1450568.02 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4403
0.1 Scale Factor Error with Delta=300 20506268
0.05 Scale Factor Error with Delta=300 82025069
0.01 Scale Factor Error with Delta=300 2050626712
DPS(e)
Combo 2 Damage Per Second (Effective)
Count 1214
Mean 1447811.00
Minimum 1301411.61
Maximum 1605704.74
Spread ( max - min ) 304293.13
Range [ ( max - min ) / 2 * 100% ] 10.51%
Damage
Combo 2 Damage
Count 1214
Mean 434511985.71
Minimum 319409354.67
Maximum 535191850.30
Spread ( max - min ) 215782495.63
Range [ ( max - min ) / 2 * 100% ] 24.83%
DTPS
Combo 2 Damage Taken Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 2 Healing Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 2 Healing Per Second (Effective)
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 2 Heal
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 2 Healing Taken Per Second
Count 1214
Mean 3044.99
Minimum 0.00
Maximum 10641.49
Spread ( max - min ) 10641.49
Range [ ( max - min ) / 2 * 100% ] 174.74%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.44 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.49 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.48 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.31 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.65 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.06 secret_technique,if=variable.secret
L 9.55 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.30 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.75 eviscerate
actions.item
# count action,conditions
O 3.73 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.71 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.32 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.94 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNDNNDMHDNFKENENNEENEELHQDNDKDMDNEENEENEEHQNDKNDDMDNEENELHQDNDKDNDDNEEMEENEEENEOEJHQPKDMIDNNDNELNQDFHKDNNDMNENEENEENERELEHQKDNDMDNDNEENEEKEEMEEELEEENEENEOEEJHQPKDIMDNDNNELHQNDFKDMDNNENEEHQNDNDKDNDNEMENEELEEEHQKDNDNDNDNEENEEKRDLEEMEEENEENEOJHEQPKDINDMNHDNQNDFKDNNDNNEME

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, realigning_nexus_convergence_divergence
0:01.004Gpotion
[cds]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence
0:01.004Jflagellation
[cds]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence, tempered_potion
0:02.009Neviscerate
[finish]
Fluffy_Pillow 86.3/100 86% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, realigning_nexus_convergence_divergence, tempered_potion
0:03.013Rvanish
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(5), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:03.013Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(5), flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:04.017Lrupture
[finish]
Fluffy_Pillow 68.9/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(5), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Hsymbols_of_death
[cds]
Combo 2 92.9/100 93% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(6), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(15), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(6), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(2), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(6), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(6), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.027Ishadow_blades
[cds]
Combo 2 69.0/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(7), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(2), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.027Ksecret_technique
[finish]
Fluffy_Pillow 69.0/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(7), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(2), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.032Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(9), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:08.035Neviscerate
[finish]
Fluffy_Pillow 77.1/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(6), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:09.040Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(3), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:10.045Neviscerate
[finish]
Fluffy_Pillow 77.3/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), flawless_form(4), shadow_techniques(10), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:11.049Neviscerate
[finish]
Fluffy_Pillow 91.6/100 92% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), flawless_form(4), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:12.052Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(3), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:13.058Mcoup_de_grace
[finish]
Fluffy_Pillow 69.5/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.261Hsymbols_of_death
[cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.261Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:15.266Neviscerate
[finish]
Fluffy_Pillow 93.6/100 94% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:16.270Fcold_blood
[cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:16.270Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(9), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:17.275Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(10), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:18.280Neviscerate
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:19.285Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:20.290Neviscerate
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, tempered_potion
0:21.295Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, tempered_potion
0:22.300Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, tempered_potion
0:23.303Ebackstab
[build]
Fluffy_Pillow 82.6/100 83% energy
4.0/7 57% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, tempered_potion
0:24.306Neviscerate
[finish]
Fluffy_Pillow 57.1/100 57% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), flagellation_persist(30), deeper_daggers, tempered_potion
0:25.311Ebackstab
[build]
Fluffy_Pillow 79.7/100 80% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, tempered_potion
0:26.314Ebackstab
[build]
Fluffy_Pillow 70.3/100 70% energy
3.0/7 43% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, tempered_potion
0:27.318Lrupture
[finish]
Fluffy_Pillow 52.9/100 53% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques, deeper_daggers, tempered_potion
0:28.322Hsymbols_of_death
[cds]
Combo 2 85.5/100 85% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, tempered_potion
0:28.322Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, tempered_potion
0:28.322Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, tempered_potion
0:29.325Neviscerate
[finish]
Fluffy_Pillow 69.6/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques(3), the_rotten, deeper_daggers, poised_shadows, tempered_potion
0:30.328Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, tempered_potion
0:31.332Ksecret_technique
[finish]
Fluffy_Pillow 77.4/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, poised_shadows
0:32.338Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(7), deeper_daggers, poised_shadows, bolstering_shadows
0:33.343Mcoup_de_grace
[finish]
Fluffy_Pillow 69.0/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows
0:34.549Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(5), deeper_daggers, bolstering_shadows
0:35.554Neviscerate
[finish]
Fluffy_Pillow 77.0/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows
0:36.560Ebackstab
[build]
Fluffy_Pillow 91.1/100 91% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows
0:37.565Ebackstab
[build]
Fluffy_Pillow 73.1/100 73% energy
4.0/7 57% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows
0:38.570Neviscerate
[finish]
Fluffy_Pillow 55.2/100 55% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers
0:39.575Ebackstab
[build]
Fluffy_Pillow 77.2/100 77% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers
0:40.580Ebackstab
[build]
Fluffy_Pillow 49.4/100 49% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers
0:41.585Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, storm_sewers_citrine
0:42.589Ebackstab
[build]
Fluffy_Pillow 42.0/100 42% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, storm_sewers_citrine
0:44.748Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(4), deeper_daggers, storm_sewers_citrine
0:45.753Hsymbols_of_death
[cds]
Combo 2 12.0/100 12% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(3), deeper_daggers, storm_sewers_citrine
0:45.753Qshadow_dance
[stealth_cds]
Combo 2 52.0/100 52% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, storm_sewers_citrine
0:45.753Neviscerate
[finish]
Fluffy_Pillow 52.0/100 52% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, storm_sewers_citrine
0:46.757Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form, premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, storm_sewers_citrine
0:47.762Ksecret_technique
[finish]
Fluffy_Pillow 59.6/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, storm_sewers_citrine
0:48.767Neviscerate
[finish]
Fluffy_Pillow 90.9/100 91% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, storm_sewers_citrine
0:49.773Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, storm_sewers_citrine
0:50.776Dshadowstrike
[build]
Fluffy_Pillow 66.3/100 66% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, storm_sewers_citrine
0:51.780Mcoup_de_grace
[finish]
Fluffy_Pillow 48.7/100 49% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste
0:52.983Dshadowstrike
[build]
Fluffy_Pillow 87.2/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste
0:53.988Neviscerate
[finish]
Fluffy_Pillow 61.6/100 62% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste
0:54.991Ebackstab
[build]
Fluffy_Pillow 80.9/100 81% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste
0:55.997Ebackstab
[build]
Fluffy_Pillow 52.2/100 52% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), deeper_daggers, nascent_empowerment_Haste
0:57.434Neviscerate
[finish]
Fluffy_Pillow 36.5/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste
0:58.437Ebackstab
[build]
Fluffy_Pillow 58.8/100 59% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(6), deeper_daggers, nascent_empowerment_Haste
0:59.442Lrupture
[finish]
Fluffy_Pillow 38.1/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste
1:00.445Hsymbols_of_death
[cds]
Combo 2 59.5/100 59% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste
1:00.445Qshadow_dance
[stealth_cds]
Combo 2 99.5/100 99% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste
1:00.445Dshadowstrike
[build]
Fluffy_Pillow 99.5/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste
1:01.449Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste
1:02.454Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste
1:03.458Ksecret_technique
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste
1:04.462Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste
1:05.465Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste
1:06.469Dshadowstrike
[build]
Fluffy_Pillow 85.7/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste
1:07.473Dshadowstrike
[build]
Fluffy_Pillow 60.1/100 60% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste
1:08.664Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers
1:09.670Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers
1:12.106Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers
1:14.372Mcoup_de_grace
[finish]
Fluffy_Pillow 37.7/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers
1:15.578Ebackstab
[build]
Fluffy_Pillow 75.8/100 76% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers
1:16.581Ebackstab
[build]
Fluffy_Pillow 50.6/100 51% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers
1:18.541Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers
1:19.545Ebackstab
[build]
Fluffy_Pillow 50.6/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers
1:22.018Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers
1:25.332Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers
1:28.227Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, fathomdwellers_runed_citrine_proc
1:29.229Ebackstab
[build]
Fluffy_Pillow 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc
1:30.233Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 21.9/100 22% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, deeper_daggers, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
1:31.514Ebackstab
[build]
Fluffy_Pillow 40.5/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
1:32.518Jflagellation
[cds]
Fluffy_Pillow 11.9/100 12% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), deeper_daggers, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
1:33.522Hsymbols_of_death
[cds]
Combo 2 27.3/100 27% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, flagellation_buff, deeper_daggers, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
1:33.522Qshadow_dance
[stealth_cds]
Combo 2 67.3/100 67% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
1:33.522Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 67.3/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
1:33.522Ksecret_technique
[finish]
Fluffy_Pillow 67.3/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:34.526Dshadowstrike
[build]
Fluffy_Pillow 88.7/100 89% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques, the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:35.531Mcoup_de_grace
[finish]
Fluffy_Pillow 63.1/100 63% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(3), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:36.736Ishadow_blades
[cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(5), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:36.736Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(5), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:37.740Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_buff(24), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:38.743Neviscerate
[finish]
Fluffy_Pillow 85.8/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), flagellation_buff(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:39.745Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:40.749Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:41.753Ebackstab
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:42.757Lrupture
[finish]
Fluffy_Pillow 73.2/100 73% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_buff(30), deeper_daggers, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:43.761Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:44.764Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:44.764Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:45.769Fcold_blood
[cds]
Combo 2 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:45.769Hsymbols_of_death
[cds]
Combo 2 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, escalating_blade(2), flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:45.769Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:46.773Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(7), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:47.777Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:48.784Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:49.788Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:50.793Mcoup_de_grace
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:51.999Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:53.004Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:54.008Neviscerate
[finish]
Fluffy_Pillow 87.4/100 87% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:55.011Ebackstab
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:56.015Ebackstab
[build]
Fluffy_Pillow 73.2/100 73% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:57.018Neviscerate
[finish]
Fluffy_Pillow 44.6/100 45% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:58.023Ebackstab
[build]
Fluffy_Pillow 64.0/100 64% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:59.028Ebackstab
[build]
Fluffy_Pillow 43.4/100 43% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:01.636Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
2:02.640Ebackstab
[build]
Fluffy_Pillow 47.1/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:05.042Rvanish
[stealth_cds]
Combo 2 41.0/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:05.042Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
2.0/7 29% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:07.017Lrupture
[finish]
Fluffy_Pillow 26.3/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(3), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:08.022Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(3), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:09.855Hsymbols_of_death
[cds]
Combo 2 30.9/100 31% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:10.023Qshadow_dance
[stealth_cds]
Combo 2 72.8/100 73% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques, the_rotten(2), poised_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:10.023Ksecret_technique
[finish]
Fluffy_Pillow 72.8/100 73% energy
4.0/7 57% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), poised_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:11.028Dshadowstrike
[build]
Fluffy_Pillow 96.6/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), poised_shadows, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:12.033Neviscerate
[finish]
Fluffy_Pillow 70.5/100 70% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:13.038Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(7), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:14.041Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:15.245Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:16.251Neviscerate
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:17.257Dshadowstrike
[build]
Fluffy_Pillow 84.7/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:18.260Neviscerate
[finish]
Fluffy_Pillow 58.5/100 59% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:19.264Ebackstab
[build]
Fluffy_Pillow 64.4/100 64% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:20.517Ebackstab
[build]
Fluffy_Pillow 45.9/100 46% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
2:22.655Neviscerate
[finish]
Fluffy_Pillow 37.0/100 37% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:23.661Ebackstab
[build]
Fluffy_Pillow 42.8/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:26.399Ebackstab
[build]
Fluffy_Pillow 40.4/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:28.890Ksecret_technique
[finish]
Fluffy_Pillow 31.3/100 31% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
2:29.895Ebackstab
[build]
Fluffy_Pillow 46.1/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit
2:32.451Ebackstab
[build]
Fluffy_Pillow 43.0/100 43% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:35.069Mcoup_de_grace
[finish]
Fluffy_Pillow 36.7/100 37% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:36.276Ebackstab
[build]
Fluffy_Pillow 74.4/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:37.281Ebackstab
[build]
Fluffy_Pillow 49.8/100 50% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:39.717Ebackstab
[build]
Fluffy_Pillow 41.5/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
2:41.505Lrupture
[finish]
Fluffy_Pillow 25.8/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
2:42.510Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
2:45.161Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
2:47.946Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
2:50.720Neviscerate
[finish]
Fluffy_Pillow 40.1/100 40% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form(2), shadow_techniques(2), flask_of_alchemical_chaos_haste
2:51.724Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:53.879Ebackstab
[build]
Fluffy_Pillow 42.6/100 43% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:56.930Neviscerate
[finish]
Fluffy_Pillow 39.9/100 40% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:57.933Ebackstab
[build]
Fluffy_Pillow 45.9/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
3:00.760Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 41.0/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
3:00.760Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:03.722Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:04.725Jflagellation
[cds]
Fluffy_Pillow 10.9/100 11% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), deeper_daggers, stormbringers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:05.728Hsymbols_of_death
[cds]
Combo 2 21.4/100 21% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flagellation_buff, stormbringers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:05.728Qshadow_dance
[stealth_cds]
Combo 2 61.4/100 61% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(3), the_rotten(2), flagellation_buff, poised_shadows, stormbringers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:05.728Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 61.4/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(3), premeditation, the_rotten(2), flagellation_buff, poised_shadows, stormbringers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:05.728Ksecret_technique
[finish]
Fluffy_Pillow 61.4/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(3), premeditation, the_rotten(2), flagellation_buff, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:06.734Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(11), poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:07.738Ishadow_blades
[cds]
Combo 2 73.6/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(11), bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:07.738Mcoup_de_grace
[finish]
Fluffy_Pillow 73.6/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(11), bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:08.945Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(7), shadow_techniques(6), the_rotten, flagellation_buff(26), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:09.949Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_buff(26), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:10.954Dshadowstrike
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:11.958Neviscerate
[finish]
Fluffy_Pillow 58.4/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(2), flawless_form(9), shadow_techniques(10), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:12.962Neviscerate
[finish]
Fluffy_Pillow 77.3/100 77% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:13.967Ebackstab
[build]
Fluffy_Pillow 96.0/100 96% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form(9), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:14.970Lrupture
[finish]
Fluffy_Pillow 66.7/100 67% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(3), flawless_form(10), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:15.973Hsymbols_of_death
[cds]
Combo 2 95.5/100 95% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:15.973Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(10), shadow_techniques(2), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:15.973Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(10), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:16.978Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(10), premeditation, shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:17.982Fcold_blood
[cds]
Combo 2 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:17.982Ksecret_technique
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(3), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:18.984Dshadowstrike
[build]
Fluffy_Pillow 96.6/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:19.988Mcoup_de_grace
[finish]
Fluffy_Pillow 70.3/100 70% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(5), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:21.195Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:22.198Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:23.203Neviscerate
[finish]
Fluffy_Pillow 84.6/100 85% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:24.207Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:25.210Neviscerate
[finish]
Fluffy_Pillow 78.8/100 79% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:26.214Ebackstab
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:27.217Ebackstab
[build]
Fluffy_Pillow 63.3/100 63% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:28.223Hsymbols_of_death
[cds]
Combo 2 42.2/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:28.223Qshadow_dance
[stealth_cds]
Combo 2 82.2/100 82% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:28.223Neviscerate
[finish]
Fluffy_Pillow 82.2/100 82% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:29.227Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:30.231Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:31.235Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:32.241Ksecret_technique
[finish]
Fluffy_Pillow 82.4/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(6), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:33.246Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form, shadow_techniques(8), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:34.251Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:35.254Dshadowstrike
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:36.257Neviscerate
[finish]
Fluffy_Pillow 68.2/100 68% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:37.262Ebackstab
[build]
Fluffy_Pillow 87.6/100 88% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:38.267Mcoup_de_grace
[finish]
Fluffy_Pillow 67.0/100 67% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:39.471Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_haste
3:40.475Neviscerate
[finish]
Fluffy_Pillow 79.4/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:41.479Ebackstab
[build]
Fluffy_Pillow 90.8/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:42.484Ebackstab
[build]
Fluffy_Pillow 70.2/100 70% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:43.488Lrupture
[finish]
Fluffy_Pillow 41.6/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:44.492Ebackstab
[build]
Fluffy_Pillow 66.0/100 66% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:45.846Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:49.002Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:50.006Hsymbols_of_death
[cds]
Combo 2 16.6/100 17% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:50.023Qshadow_dance
[stealth_cds]
Combo 2 56.8/100 57% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(5), shadow_techniques, the_rotten(2), poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:50.023Ksecret_technique
[finish]
Fluffy_Pillow 56.8/100 57% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(5), premeditation, shadow_techniques, the_rotten(2), poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:51.027Dshadowstrike
[build]
Fluffy_Pillow 91.2/100 91% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form, premeditation, shadow_techniques(3), the_rotten(2), poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:52.032Neviscerate
[finish]
Fluffy_Pillow 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(5), the_rotten, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:53.038Dshadowstrike
[build]
Fluffy_Pillow 92.1/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:54.042Neviscerate
[finish]
Fluffy_Pillow 66.5/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:55.047Dshadowstrike
[build]
Fluffy_Pillow 77.9/100 78% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:56.049Neviscerate
[finish]
Fluffy_Pillow 52.3/100 52% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:57.054Dshadowstrike
[build]
Fluffy_Pillow 66.7/100 67% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:58.058Neviscerate
[finish]
Fluffy_Pillow 41.1/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:59.063Ebackstab
[build]
Fluffy_Pillow 60.5/100 60% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
4:00.751Ebackstab
[build]
Fluffy_Pillow 47.4/100 47% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:02.683Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
4:03.688Ebackstab
[build]
Fluffy_Pillow 47.1/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
4:06.459Ebackstab
[build]
Fluffy_Pillow 45.0/100 45% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:08.447Ksecret_technique
[finish]
Fluffy_Pillow 30.4/100 30% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:09.452Rvanish
[stealth_cds]
Combo 2 50.3/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:09.452Dshadowstrike
[build]
Fluffy_Pillow 50.3/100 50% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:11.014Lrupture
[finish]
Fluffy_Pillow 26.1/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(3), bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:12.017Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(3), bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:14.449Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:17.320Mcoup_de_grace
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:18.525Ebackstab
[build]
Fluffy_Pillow 78.2/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:19.532Ebackstab
[build]
Fluffy_Pillow 49.1/100 49% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:22.095Ebackstab
[build]
Fluffy_Pillow 40.7/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:24.734Neviscerate
[finish]
Fluffy_Pillow 37.2/100 37% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:25.738Ebackstab
[build]
Fluffy_Pillow 43.1/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:28.524Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:31.332Neviscerate
[finish]
Fluffy_Pillow 35.4/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
4:32.336Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
4:33.339Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 16.1/100 16% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
4:34.603Jflagellation
[cds]
Fluffy_Pillow 33.7/100 34% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
4:35.726Hsymbols_of_death
[cds]
Combo 2 49.9/100 50% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(3), flagellation_buff, deeper_daggers, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:35.726Ebackstab
[build]
Fluffy_Pillow 89.9/100 90% energy
2.0/7 29% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), shadow_techniques(3), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:36.732Qshadow_dance
[stealth_cds]
Combo 2 68.7/100 69% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), shadow_techniques(2), the_rotten, flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:36.732Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 68.7/100 69% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), premeditation, shadow_techniques(2), the_rotten, flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:36.732Ksecret_technique
[finish]
Fluffy_Pillow 68.7/100 69% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), premeditation, shadow_techniques(2), the_rotten, flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:37.736Dshadowstrike
[build]
Fluffy_Pillow 94.6/100 95% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten, flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:38.740Ishadow_blades
[cds]
Combo 2 68.4/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), flagellation_buff(10), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:38.740Neviscerate
[finish]
Fluffy_Pillow 68.4/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), flagellation_buff(10), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:39.745Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(8), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:40.749Mcoup_de_grace
[finish]
Fluffy_Pillow 66.1/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(8), flagellation_buff(20), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:41.953Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:42.958Hsymbols_of_death
[cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:42.958Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:43.965Neviscerate
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:44.969Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(2), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:44.969Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), premeditation, shadow_techniques(2), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:45.974Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), premeditation, shadow_techniques(4), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:46.977Fcold_blood
[cds]
Combo 2 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:46.977Ksecret_technique
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:47.982Dshadowstrike
[build]
Fluffy_Pillow 98.2/100 98% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:48.988Neviscerate
[finish]
Fluffy_Pillow 64.2/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:49.992Neviscerate
[finish]
Fluffy_Pillow 91.3/100 91% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:50.997Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:52.001Neviscerate
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:53.008Neviscerate
[finish]
Fluffy_Pillow 85.2/100 85% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:54.011Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:55.016Mcoup_de_grace
[finish]
Fluffy_Pillow 79.1/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:56.221Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit19.61%20.03%5620
Haste2.35%2.79%1843
Versatility28.63%21.09%16453
Attack Power6162857457938
Mastery59.01%47.03%7838
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Ring of Dun Algaz
ilevel: 639, stats: { +13,614 Sta, +2,102 Crit, +4,028 Vers }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 2"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=ring_of_dun_algaz,id=133287,bonus_id=10390/6652/10394/10878/10383/10299/11342/10255
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=5510
# gear_haste_rating=1807
# gear_mastery_rating=7684
# gear_versatility_rating=16130
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 3 : 1,412,841 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,412,840.51,412,840.52,653.2 / 0.188%178,810.2 / 12.7%47,293.5
Resource Out In Waiting APM Active
Energy29.829.711.76%57.1100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 31,412,841
Auto Attack 0 (74,318)0.0% (5.3%)3.9122.39s5,687,0130

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 49,6103.5%354.60.99s42,00942,859Direct354.639,55379,74342,00922.2%16.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage354.56354.560.000.000.000.98020.000014,894,678.2919,421,431.6923.31%42,859.4242,859.42
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit61.51%218.0714729739,552.8125,09063,29439,562.7837,72941,5238,625,16411,247,19623.31%
crit22.18%78.624411679,742.6250,256126,77879,790.3373,31688,8886,269,5148,174,23623.30%
miss16.32%57.8632840.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 24,7081.7%353.90.99s20,96021,314Direct353.919,70239,74920,95922.3%16.3%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage353.91353.910.000.000.000.98340.00007,417,713.889,672,219.2623.31%21,314.2921,314.29
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit61.48%217.5815529119,701.8812,35931,51819,708.1518,74820,9464,286,6965,589,75423.31%
crit22.26%78.773911939,748.6224,75563,13039,773.3436,44244,5303,131,0184,082,46523.31%
miss16.26%57.5628900.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 31,9542.3%75.33.69s127,639127,069Direct75.375,238194,300127,59044.0%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.3175.310.000.000.001.00450.00009,612,760.7812,564,822.4723.49%127,068.88127,068.88
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.01%42.18246375,237.5859,362146,87475,237.8971,59379,1683,173,5794,149,95223.52%
crit43.99%33.131552194,300.18130,810421,475194,442.26179,811216,4046,439,1828,414,87123.49%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.31

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 89,888 (128,303)6.4% (9.1%)13.322.48s2,898,0802,406,172Direct39.8 (78.3)511,1301,030,657678,21932.2% (32.0%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2839.760.000.000.001.20450.000026,960,798.6435,092,374.7423.17%2,406,171.772,406,171.77
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.83%26.971442511,130.08119,0621,858,522511,282.25353,330692,08313,784,77717,943,04123.18%
crit32.17%12.795251,030,657.17238,4803,655,4781,029,450.47525,6991,783,80713,176,02217,149,33423.18%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.28
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 38,4152.7%0.00.00s00Direct38.5226,087456,001299,36531.9%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.500.000.000.000.00000.000011,523,512.6611,523,512.660.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit68.14%26.241142226,086.5356,408785,237226,487.28154,622312,8155,929,8875,929,8870.00%
crit31.86%12.27323456,000.78113,6941,615,005455,810.01225,604777,2985,593,6265,593,6260.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (20,748)0.0% (1.5%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 20,7481.5%22.412.80s277,6730Direct22.4277,7890277,7890.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.4422.430.000.000.000.00000.00006,230,720.756,230,720.750.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.431138277,788.84270,713310,011277,767.76272,469285,2676,230,7216,230,7210.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 257,208 (368,398)18.2% (26.1%)68.74.38s1,609,1231,601,924Direct68.7 (136.3)844,8101,725,9271,123,84831.7% (31.8%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.7068.700.000.000.001.00450.000077,186,896.93100,396,639.0923.12%1,601,924.491,601,924.49
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit68.34%46.952867844,810.22209,6622,329,814844,633.59667,0541,004,34439,662,28251,591,29623.12%
crit31.66%21.759361,725,926.81419,9524,628,3131,725,947.571,206,6272,330,90137,524,61548,805,34423.11%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.71

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 111,1907.9%67.64.45s493,4370Direct67.6370,911753,657493,51232.0%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.6267.620.000.000.000.00000.000033,366,717.5733,366,717.570.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.97%45.962965370,911.1899,9551,002,460370,803.00305,431444,77417,042,96717,042,9670.00%
crit32.03%21.66838753,657.40200,2092,024,545753,770.82518,1261,190,03516,323,75016,323,7500.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,089 (22,057)0.1% (1.6%)3.791.43s1,781,1941,773,617Direct3.7 (27.5)72,074143,86187,63321.7% (22.5%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.723.720.000.000.001.00450.0000326,013.58326,013.580.00%1,773,616.851,773,616.85
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit78.32%2.910472,073.7563,295140,94771,781.490102,057209,978209,9780.00%
crit21.68%0.8104143,861.24126,779264,61884,896.480264,618116,036116,0360.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 20,9681.5%0.00.00s00Direct23.8215,856431,835264,95722.7%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.790.000.000.000.00000.00006,298,445.366,298,445.360.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.32%18.391027215,856.3980,650457,648215,660.13179,125255,7383,969,0353,969,0350.00%
crit22.68%5.39013431,834.86171,750891,280431,371.720862,6012,329,4102,329,4100.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,8450.9%0.00.00s00Direct283.111,11122,39713,62622.3%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00283.070.000.000.000.00000.00003,856,899.473,856,899.470.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.71%219.9915629611,111.287,80617,27711,111.7810,56011,7802,444,1102,444,1100.00%
crit22.29%63.08349922,397.3415,63634,60522,408.5320,07625,0871,412,7891,412,7890.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 98,595 (116,762)7.0% (8.3%)9.531.35s3,673,0763,656,983Periodic167.2 (334.5)133,198274,862176,97330.9% (31.0%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.540.00167.25167.257.041.00451.744229,595,055.2229,595,055.220.00%116,323.573,656,982.85
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit69.09%115.5682151133,197.9577401,552133,266.33112,449149,91715,393,28315,393,2830.00%
crit30.91%51.692777274,861.86136800,473275,108.35219,500347,11314,201,77214,201,7720.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.54
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,1681.3%167.21.77s32,6070Periodic167.224,47850,67332,61331.0%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.250.000.00167.250.000.00000.00005,453,468.375,453,468.370.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit68.95%115.327915124,478.029,61673,62924,492.2621,23228,5942,822,7652,822,7650.00%
crit31.05%51.93298250,672.6619,260146,40150,731.7140,74263,1652,630,7032,630,7030.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (270,121)0.0% (19.1%)16.018.98s5,052,3725,030,058

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.040.000.000.000.001.00450.00000.000.000.00%5,030,058.085,030,058.08

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.04
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,5884.9%0.00.00s00Direct16.0669,2122,052,8511,301,78545.7%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.040.000.000.000.00000.000020,879,408.5127,205,628.7123.25%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit54.28%8.71414669,211.89149,7581,555,914671,079.58383,419988,7165,827,1727,610,17223.43%
crit45.72%7.333132,052,851.22310,9663,919,7312,089,358.211,260,5563,138,04315,052,23619,595,45623.18%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 200,53314.2%0.00.00s00Direct32.0975,0622,948,4471,881,35745.9%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.990.000.000.000.00000.000060,174,947.4760,174,947.470.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit54.07%17.30927975,062.25220,3582,250,037976,458.38710,2931,290,13116,859,94316,859,9430.00%
crit45.93%14.697242,948,446.68444,2645,668,3982,976,334.562,099,0404,194,69143,315,00443,315,0040.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (106,465)0.0% (7.5%)3.690.97s8,765,4140

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.65
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 106,4657.5%384.71.20s83,1120Periodic384.783,125083,1250.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage384.680.000.00384.680.000.00000.000031,971,377.5731,971,377.570.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%384.6828847683,124.69671,049,70283,180.7169,49199,13931,971,37831,971,3780.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14411.54
  • base_dd_max:14411.54
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 122,2248.6%52.55.84s697,335694,221Direct52.5288,927937,560697,48363.0%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.5252.520.000.000.001.00450.000036,624,999.4447,739,247.8323.28%694,220.66694,220.66
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit37.02%19.451029288,927.41135,328411,406288,882.64250,028318,4375,618,2117,319,06023.24%
crit62.98%33.082144937,560.40298,2081,390,994938,331.99868,1131,047,87731,006,78840,420,18723.29%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.51

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Suffocating Darkness 48,8413.5%19.215.40s763,4020Periodic107.6136,2790136,2790.0%0.0%71.7%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.210.00107.65107.6512.250.00002.000014,664,996.2214,664,996.220.00%68,117.090.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.6559154136,279.4463,367217,698135,278.9967,637180,53414,664,99614,664,9960.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Unseen Blade 89,8036.4%58.15.18s464,2460Direct58.1379,309760,168464,34722.3%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.0758.070.000.000.000.00000.000026,956,490.6435,195,482.5023.41%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.69%45.112662379,308.67229,417557,957379,494.94348,940412,13217,108,77922,340,38323.42%
crit22.31%12.96326760,168.19459,5231,117,588761,371.70593,923956,5289,847,71212,855,09923.40%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 3
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.84s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.792.69s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.730.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5310.68s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.490.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.49
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 99.03.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.970.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Shadow Dance 13.323.26s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.330.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.33
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Symbols of Death 14.321.43s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.310.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.31
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.39s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.92
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1592.0171.9s0.5s281.6s99.94%100.00%582.4 (582.4)0.1

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:22.4s / 325.5s
  • trigger_min/max:0.0s / 4.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 359.9s
  • uptime_min/max:99.21% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.20%
  • acrobatic_strikes_4:0.17%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.15%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.36%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.3118.3s3.5s126.1s97.28%0.00%73.8 (76.7)1.3

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 331.1s
  • trigger_min/max:1.0s / 40.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 357.4s
  • uptime_min/max:87.76% / 99.44%

Stack Uptimes

  • alacrity_1:3.00%
  • alacrity_2:2.27%
  • alacrity_3:1.90%
  • alacrity_4:1.67%
  • alacrity_5:88.44%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.50%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.018.9s18.9s6.9s37.01%100.00%0.0 (0.0)15.7

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 61.9s
  • trigger_min/max:9.2s / 61.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:31.50% / 41.57%

Stack Uptimes

  • bolstering_shadows_1:37.01%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.2s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:81.9s / 103.9s
  • trigger_min/max:81.9s / 103.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.10%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.30.0127.7s110.4s4.3s1.85%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 279.3s
  • trigger_min/max:90.0s / 187.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.4s
  • uptime_min/max:0.00% / 7.30%

Stack Uptimes

  • cryptic_instructions_1:1.85%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.348.023.2s23.2s8.2s36.47%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 70.9s
  • trigger_min/max:8.0s / 70.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.84% / 39.52%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.55%
  • danse_macabre_3:6.66%
  • danse_macabre_4:16.42%
  • danse_macabre_5:8.79%
  • danse_macabre_6:0.02%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.340.8s3.7s35.4s90.00%95.63%74.3 (74.3)6.7

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 168.0s
  • trigger_min/max:1.0s / 39.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 153.7s
  • uptime_min/max:81.30% / 96.33%

Stack Uptimes

  • deeper_daggers_1:90.00%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.018.9s18.9s3.4s18.43%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 61.9s
  • trigger_min/max:9.2s / 61.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:14.95% / 21.21%

Stack Uptimes

  • disorienting_strikes_1:12.22%
  • disorienting_strikes_2:6.21%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.30.0129.2s111.7s4.0s1.70%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 325.2s
  • trigger_min/max:90.0s / 189.8s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 10.5s
  • uptime_min/max:0.00% / 7.48%

Stack Uptimes

  • errant_manaforge_emission_1:1.70%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.144.022.1s5.2s17.4s81.65%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 61.2s
  • trigger_min/max:1.0s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.6s
  • uptime_min/max:64.19% / 91.93%

Stack Uptimes

  • escalating_blade_1:24.78%
  • escalating_blade_2:22.17%
  • escalating_blade_3:22.77%
  • escalating_blade_4:11.94%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.8s90.8s14.7s18.15%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:82.7s / 183.3s
  • trigger_min/max:82.7s / 183.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s
  • uptime_min/max:12.51% / 20.82%

Stack Uptimes

  • ethereal_powerlink_1:18.15%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.723.991.3s9.7s11.8s14.63%0.00%14.3 (95.7)3.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.3s
  • trigger_min/max:1.0s / 87.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.97% / 16.90%

Stack Uptimes

  • flagellation_buff_1:1.33%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.77%
  • flagellation_buff_9:0.61%
  • flagellation_buff_10:0.54%
  • flagellation_buff_11:0.47%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.06%
  • flagellation_buff_19:0.41%
  • flagellation_buff_20:0.39%
  • flagellation_buff_21:0.31%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.21%
  • flagellation_buff_25:0.83%
  • flagellation_buff_26:0.37%
  • flagellation_buff_27:0.21%
  • flagellation_buff_28:0.20%
  • flagellation_buff_29:0.00%
  • flagellation_buff_30:7.08%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.0s91.0s11.8s14.20%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.1s / 98.3s
  • trigger_min/max:78.1s / 98.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.29% / 16.22%

Stack Uptimes

  • flagellation_persist_23:0.00%
  • flagellation_persist_26:0.00%
  • flagellation_persist_30:14.19%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6114.4s77.9s34.9s24.29%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.6s / 344.5s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 150.0s
  • uptime_min/max:0.00% / 73.30%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.29%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.20.6112.7s76.1s35.4s25.44%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 353.7s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 178.9s
  • uptime_min/max:0.00% / 68.83%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.44%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.20.7109.5s75.3s35.6s25.59%0.00%3.0 (3.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.8s / 331.7s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 75.35%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.59%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6110.9s78.1s34.9s24.67%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.8s / 335.2s
  • trigger_min/max:30.0s / 270.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 210.0s
  • uptime_min/max:0.00% / 76.80%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.67%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.40.039.9s3.4s59.6s95.34%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.63%
  • flawless_form_2:8.86%
  • flawless_form_3:11.84%
  • flawless_form_4:9.68%
  • flawless_form_5:2.73%
  • flawless_form_6:4.47%
  • flawless_form_7:5.82%
  • flawless_form_8:11.37%
  • flawless_form_9:18.56%
  • flawless_form_10:8.73%
  • flawless_form_11:1.33%
  • flawless_form_12:0.07%
  • flawless_form_14:0.01%
  • flawless_form_15:0.16%
  • flawless_form_16:0.08%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.287.1s73.4s16.9s11.00%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:2.5s / 331.3s
  • trigger_min/max:0.2s / 331.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.0s
  • uptime_min/max:0.00% / 45.94%

Stack Uptimes

  • nascent_empowerment_Crit_1:11.00%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.289.4s74.2s16.8s10.46%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.0s / 307.4s
  • trigger_min/max:0.2s / 307.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 48.8s
  • uptime_min/max:0.00% / 42.75%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.46%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)2.00.285.9s72.0s17.1s11.09%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:0.5s / 303.9s
  • trigger_min/max:0.3s / 303.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 57.5s
  • uptime_min/max:0.00% / 39.02%

Stack Uptimes

  • nascent_empowerment_Mastery_1:11.09%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.285.9s73.7s16.7s10.74%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:4.1s / 307.9s
  • trigger_min/max:0.5s / 307.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 49.3s
  • uptime_min/max:0.00% / 37.20%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.74%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.90.422.1s21.3s3.7s17.06%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 85.2s
  • trigger_min/max:1.0s / 63.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.3s
  • uptime_min/max:9.80% / 27.05%

Stack Uptimes

  • poised_shadows_1:17.06%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.30.017.9s18.9s1.1s2.58%11.22%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 67.4s
  • trigger_min/max:1.0s / 67.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.80% / 5.07%

Stack Uptimes

  • premeditation_1:2.58%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0133.3s110.3s4.0s1.59%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.3s
  • trigger_min/max:90.0s / 189.9s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 12.1s
  • uptime_min/max:0.00% / 6.59%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.59%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shadow Blades3.60.090.8s90.8s15.8s19.17%17.13%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 100.1s
  • trigger_min/max:90.0s / 100.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 16.0s
  • uptime_min/max:16.85% / 21.88%

Stack Uptimes

  • shadow_blades_1:19.17%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.2s23.2s8.2s36.47%100.00%0.0 (0.0)13.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 70.9s
  • trigger_min/max:8.0s / 70.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.84% / 39.52%

Stack Uptimes

  • shadow_dance_1:36.47%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.0138.74.4s1.5s3.5s79.15%95.47%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 48.9s
  • trigger_min/max:0.5s / 6.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.9s
  • uptime_min/max:70.14% / 86.34%

Stack Uptimes

  • shadow_techniques_1:20.48%
  • shadow_techniques_2:20.83%
  • shadow_techniques_3:9.30%
  • shadow_techniques_4:10.60%
  • shadow_techniques_5:6.10%
  • shadow_techniques_6:5.89%
  • shadow_techniques_7:2.58%
  • shadow_techniques_8:2.33%
  • shadow_techniques_9:0.51%
  • shadow_techniques_10:0.46%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.02%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s298.4s99.32%85.90%99.0 (99.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.0s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.50.0111.2s102.4s9.9s1.80%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.1s / 281.8s
  • trigger_min/max:1.0s / 272.4s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 13.4s
  • uptime_min/max:0.00% / 12.10%

Stack Uptimes

  • storm_sewers_citrine_1:1.80%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.0108.2s100.3s10.0s1.85%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:2.0s / 318.2s
  • trigger_min/max:1.0s / 318.2s
  • trigger_pct:100.00%
  • duration_min/max:1.5s / 19.8s
  • uptime_min/max:0.00% / 12.92%

Stack Uptimes

  • storm_sewers_citrine_1:1.85%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.0103.7s94.3s9.9s1.88%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.2s / 298.1s
  • trigger_min/max:1.0s / 298.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.9s
  • uptime_min/max:0.00% / 13.19%

Stack Uptimes

  • storm_sewers_citrine_1:1.88%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.4s21.4s2.3s11.02%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 63.6s
  • trigger_min/max:4.0s / 63.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:9.11% / 15.05%

Stack Uptimes

  • supercharge_1_1:11.02%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.06%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 63.6s
  • trigger_min/max:1.2s / 63.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:0.63% / 7.53%

Stack Uptimes

  • supercharge_2_1:2.06%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.8s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.7s
  • uptime_min/max:0.00% / 2.66%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s3.8s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 6.5s
  • uptime_min/max:0.00% / 2.24%

Stack Uptimes

  • supercharge_4_1:0.01%

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.46.943.7s21.3s24.6s61.13%100.00%6.9 (6.9)6.9

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.3s / 97.7s
  • trigger_min/max:1.0s / 63.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:57.84% / 65.28%

Stack Uptimes

  • symbols_of_death_1:61.13%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.8s307.8s27.6s13.43%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.5s
  • trigger_min/max:300.0s / 329.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s
  • uptime_min/max:9.95% / 18.09%

Stack Uptimes

  • tempered_potion_1:13.43%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.69%3.79%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.40% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.69%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.4s21.3s2.9s13.78%22.30%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:4.0s / 63.6s
  • trigger_min/max:1.0s / 63.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.4s
  • uptime_min/max:11.56% / 16.51%

Stack Uptimes

  • the_rotten_1:10.73%
  • the_rotten_2:3.05%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.09%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 133.1s
  • trigger_min/max:120.0s / 133.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.38%

Stack Uptimes

  • vanish_1:0.09%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.628.077.06.0s0.7s61.1s
Skyfury (Off Hand)49.527.077.06.0s0.7s68.7s
Supercharger secret_technique12.47.016.023.7s9.2s90.4s
Cold Blood secret_technique3.63.04.090.7s81.9s103.9s
Supercharger rupture0.30.02.0184.3s48.6s274.9s
Supercharger coup_de_grace2.80.09.075.2s9.5s325.7s
Supercharger eviscerate13.07.022.023.2s1.0s153.7s
CP Spent During Flagellation201.7133.0247.011.2s1.0s89.9s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.30%6.42%13.15%0.7s0.0s2.3s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 3
Energy RegenEnergy1,429.763,037.6234.09%2.12395.4311.52%
Improved AmbushCombo Points52.5133.734.60%0.6418.7935.77%
PremeditationCombo Points17.2457.037.78%3.3163.6352.73%
Relentless StrikesEnergy107.574,280.3548.03%39.79123.572.81%
Shadow BladesCombo Points21.92113.8815.54%5.1917.6613.42%
Shadow TechniquesEnergy360.041,235.2613.86%3.43204.9014.23%
Shadow TechniquesCombo Points85.72241.2732.93%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.27106.9214.59%7.000.000.00%
BackstabCombo Points75.3174.9510.23%1.000.360.48%
ShadowstrikeCombo Points52.51104.9914.33%2.000.040.04%
Symbols of DeathEnergy14.31358.024.02%25.03214.1837.43%
Usage Type Count Total Tot% Avg RPE APR
Combo 3
BackstabEnergy75.313,012.3333.60%40.0040.003,191.14
Coup de GraceEnergy13.28464.685.18%35.0034.9982,819.34
Coup de GraceCombo Points13.2890.6312.43%6.836.82424,651.60
EviscerateEnergy68.712,404.8426.83%35.0035.0045,971.36
EviscerateCombo Points68.71468.1264.22%6.816.81236,163.52
RuptureEnergy9.54238.502.66%25.0024.99146,954.48
RuptureCombo Points9.5465.238.95%6.846.84537,279.81
Secret TechniqueEnergy16.04481.175.37%30.0029.99168,451.04
Secret TechniqueCombo Points16.04104.9314.40%6.546.54772,486.32
ShadowstrikeEnergy52.512,363.1626.36%45.0044.9915,498.31
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.6629.84938.146.70.1100.0
Combo Points0.02.442.43100.43.80.07.0

Statistics & Data Analysis

Fight Length
Combo 3 Fight Length
Count 1214
Mean 300.42
Minimum 240.02
Maximum 359.88
Spread ( max - min ) 119.87
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
Combo 3 Damage Per Second
Count 1214
Mean 1412840.51
Minimum 1285258.98
Maximum 1567906.20
Spread ( max - min ) 282647.22
Range [ ( max - min ) / 2 * 100% ] 10.00%
Standard Deviation 47166.9922
5th Percentile 1337009.92
95th Percentile 1491886.31
( 95th Percentile - 5th Percentile ) 154876.39
Mean Distribution
Standard Deviation 1353.7200
95.00% Confidence Interval ( 1410187.27 - 1415493.75 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4282
0.1 Scale Factor Error with Delta=300 18991534
0.05 Scale Factor Error with Delta=300 75966134
0.01 Scale Factor Error with Delta=300 1899153349
Priority Target DPS
Combo 3 Priority Target Damage Per Second
Count 1214
Mean 1412840.51
Minimum 1285258.98
Maximum 1567906.20
Spread ( max - min ) 282647.22
Range [ ( max - min ) / 2 * 100% ] 10.00%
Standard Deviation 47166.9922
5th Percentile 1337009.92
95th Percentile 1491886.31
( 95th Percentile - 5th Percentile ) 154876.39
Mean Distribution
Standard Deviation 1353.7200
95.00% Confidence Interval ( 1410187.27 - 1415493.75 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4282
0.1 Scale Factor Error with Delta=300 18991534
0.05 Scale Factor Error with Delta=300 75966134
0.01 Scale Factor Error with Delta=300 1899153349
DPS(e)
Combo 3 Damage Per Second (Effective)
Count 1214
Mean 1412840.51
Minimum 1285258.98
Maximum 1567906.20
Spread ( max - min ) 282647.22
Range [ ( max - min ) / 2 * 100% ] 10.00%
Damage
Combo 3 Damage
Count 1214
Mean 423995901.33
Minimum 333613467.15
Maximum 514061112.60
Spread ( max - min ) 180447645.45
Range [ ( max - min ) / 2 * 100% ] 21.28%
DTPS
Combo 3 Damage Taken Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 3 Healing Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 3 Healing Per Second (Effective)
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 3 Heal
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 3 Healing Taken Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.51 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.31 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.49 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.31 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.65 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.04 secret_technique,if=variable.secret
L 9.54 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.28 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.71 eviscerate
actions.item
# count action,conditions
O 3.73 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.70 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.33 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.92 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNNDHMFKDNNENNEENEEHQNDKDNDMDLENENHQDNDKDDMDNEENENEEHQNDKDNDNDLEENEENEMEEENEEOJHQPKDMDINDNNELEQFKNHDMDNNDNEENEENERELEEHQKDMDNDNDNEENEKEEEMEEELEEENEEEMEOEJHQPKDNDINDNDLENHQNDFKNDMDNNEENHQDNDKDMDDNEENELEENEEHQKDMDNDNDNENEREKENEEELEEEMEENOEJHQPKDNDINDNNEHQNDNFKDMDNLENNENE

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, errant_manaforge_emission
0:01.005Gpotion
[cds]
Fluffy_Pillow 69.1/100 69% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, errant_manaforge_emission
0:01.005Jflagellation
[cds]
Fluffy_Pillow 69.1/100 69% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, errant_manaforge_emission, tempered_potion
0:02.008Neviscerate
[finish]
Fluffy_Pillow 87.8/100 88% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(5), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, errant_manaforge_emission, tempered_potion
0:03.012Rvanish
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(6), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, errant_manaforge_emission, tempered_potion
0:03.012Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(6), alacrity, flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, errant_manaforge_emission, tempered_potion
0:04.017Lrupture
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, errant_manaforge_emission, tempered_potion
0:05.023Hsymbols_of_death
[cds]
Combo 3 98.8/100 99% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(15), deeper_daggers, errant_manaforge_emission, tempered_potion
0:05.023Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(3), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, errant_manaforge_emission, tempered_potion
0:05.023Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, errant_manaforge_emission, tempered_potion
0:05.023Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.030Ishadow_blades
[cds]
Combo 3 78.0/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.030Ksecret_technique
[finish]
Fluffy_Pillow 78.0/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.035Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(9), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:08.040Neviscerate
[finish]
Fluffy_Pillow 78.1/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(9), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:09.045Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:10.049Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:11.053Neviscerate
[finish]
Fluffy_Pillow 86.2/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(10), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:12.059Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:13.066Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(7), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.071Hsymbols_of_death
[cds]
Combo 3 78.4/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), shadow_techniques(9), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.071Mcoup_de_grace
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(4), shadow_techniques(9), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:15.277Fcold_blood
[cds]
Combo 3 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:15.277Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(9), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:16.281Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(10), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:17.286Neviscerate
[finish]
Fluffy_Pillow 78.4/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(11), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:18.292Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:19.295Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:20.300Neviscerate
[finish]
Fluffy_Pillow 91.4/100 91% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, tempered_potion
0:21.305Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, tempered_potion
0:22.311Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, tempered_potion
0:23.316Ebackstab
[build]
Fluffy_Pillow 91.4/100 91% energy
3.0/7 43% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, tempered_potion
0:24.321Neviscerate
[finish]
Fluffy_Pillow 74.8/100 75% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, tempered_potion
0:25.325Ebackstab
[build]
Fluffy_Pillow 90.2/100 90% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), deeper_daggers, tempered_potion
0:26.329Ebackstab
[build]
Fluffy_Pillow 81.5/100 82% energy
4.0/7 57% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, tempered_potion
0:27.335Hsymbols_of_death
[cds]
Combo 3 64.9/100 65% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, tempered_potion
0:27.335Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, tempered_potion
0:27.335Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, tempered_potion
0:28.339Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form, premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, tempered_potion
0:29.342Ksecret_technique
[finish]
Fluffy_Pillow 78.4/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form, shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, tempered_potion
0:30.347Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Vers, tempered_potion
0:31.353Neviscerate
[finish]
Fluffy_Pillow 78.2/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers
0:32.356Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(8), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers
0:33.362Mcoup_de_grace
[finish]
Fluffy_Pillow 69.9/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit
0:34.568Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit
0:35.571Lrupture
[finish]
Fluffy_Pillow 85.8/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit
0:36.575Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(8), deeper_daggers, nascent_empowerment_Crit
0:37.579Neviscerate
[finish]
Fluffy_Pillow 82.8/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit
0:38.584Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(6), deeper_daggers, nascent_empowerment_Crit
0:39.589Neviscerate
[finish]
Fluffy_Pillow 82.8/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit
0:40.594Hsymbols_of_death
[cds]
Combo 3 95.7/100 96% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit
0:40.594Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(10), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit
0:40.594Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(10), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit
0:41.598Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(10), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit
0:42.602Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(9), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit
0:43.608Ksecret_technique
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit
0:44.612Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit
0:45.616Dshadowstrike
[build]
Fluffy_Pillow 66.4/100 66% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit
0:46.621Mcoup_de_grace
[finish]
Fluffy_Pillow 40.8/100 41% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit
0:47.826Dshadowstrike
[build]
Fluffy_Pillow 87.5/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit
0:48.832Neviscerate
[finish]
Fluffy_Pillow 61.9/100 62% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit
0:49.837Ebackstab
[build]
Fluffy_Pillow 81.3/100 81% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit
0:50.843Ebackstab
[build]
Fluffy_Pillow 60.8/100 61% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit
0:52.240Neviscerate
[finish]
Fluffy_Pillow 36.6/100 37% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques, deeper_daggers, nascent_empowerment_Crit
0:53.243Ebackstab
[build]
Fluffy_Pillow 64.0/100 64% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers
0:54.248Neviscerate
[finish]
Fluffy_Pillow 43.4/100 43% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, storm_sewers_citrine
0:55.254Ebackstab
[build]
Fluffy_Pillow 57.9/100 58% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, storm_sewers_citrine
0:56.632Ebackstab
[build]
Fluffy_Pillow 41.5/100 42% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, storm_sewers_citrine
0:57.638Hsymbols_of_death
[cds]
Combo 3 12.9/100 13% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, storm_sewers_citrine
0:57.638Qshadow_dance
[stealth_cds]
Combo 3 52.9/100 53% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, storm_sewers_citrine
0:57.638Neviscerate
[finish]
Fluffy_Pillow 52.9/100 53% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, storm_sewers_citrine
0:58.643Dshadowstrike
[build]
Fluffy_Pillow 87.3/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, storm_sewers_citrine
0:59.648Ksecret_technique
[finish]
Fluffy_Pillow 61.8/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, storm_sewers_citrine
1:00.654Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, storm_sewers_citrine
1:01.658Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, storm_sewers_citrine
1:02.662Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, storm_sewers_citrine
1:03.666Neviscerate
[finish]
Fluffy_Pillow 60.2/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, bolstering_shadows, storm_sewers_citrine
1:04.671Dshadowstrike
[build]
Fluffy_Pillow 71.6/100 72% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, bolstering_shadows
1:05.674Lrupture
[finish]
Fluffy_Pillow 45.6/100 46% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:06.680Ebackstab
[build]
Fluffy_Pillow 69.5/100 69% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
1:07.683Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), deeper_daggers, flask_of_alchemical_chaos_vers
1:09.529Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
1:10.533Ebackstab
[build]
Fluffy_Pillow 42.1/100 42% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
1:12.572Ebackstab
[build]
Fluffy_Pillow 40.1/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
1:15.546Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
1:16.551Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers
1:18.298Mcoup_de_grace
[finish]
Fluffy_Pillow 37.9/100 38% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
1:19.503Ebackstab
[build]
Fluffy_Pillow 70.9/100 71% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
1:20.508Ebackstab
[build]
Fluffy_Pillow 45.7/100 46% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
1:22.959Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
1:25.920Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
1:26.925Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
1:29.355Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
1:30.361Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 16.1/100 16% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
1:30.823Jflagellation
[cds]
Fluffy_Pillow 21.1/100 21% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
1:32.009Hsymbols_of_death
[cds]
Combo 3 33.9/100 34% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, flagellation_buff, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
1:32.009Qshadow_dance
[stealth_cds]
Combo 3 73.9/100 74% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
1:32.009Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 73.9/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
1:32.009Ksecret_technique
[finish]
Fluffy_Pillow 73.9/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:33.015Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:34.019Mcoup_de_grace
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(5), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:35.225Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:36.229Ishadow_blades
[cds]
Combo 3 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(5), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:36.229Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(5), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:37.234Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:38.239Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(11), shadow_techniques(9), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:39.245Neviscerate
[finish]
Fluffy_Pillow 85.2/100 85% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:40.250Ebackstab
[build]
Fluffy_Pillow 96.0/100 96% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:41.256Lrupture
[finish]
Fluffy_Pillow 74.8/100 75% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:42.260Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:43.264Qshadow_dance
[stealth_cds]
Combo 3 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:43.264Fcold_blood
[cds]
Combo 3 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), premeditation, shadow_techniques(8), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:43.264Ksecret_technique
[finish]
Fluffy_Pillow 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, escalating_blade(3), flawless_form(10), premeditation, shadow_techniques(8), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:44.267Neviscerate
[finish]
Fluffy_Pillow 94.6/100 95% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(10), premeditation, shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:45.270Hsymbols_of_death
[cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(9), premeditation, shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:45.270Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes(2), escalating_blade(3), flawless_form(9), premeditation, shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:46.276Mcoup_de_grace
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes, escalating_blade(4), flawless_form(5), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:47.481Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
1:48.486Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(10), shadow_techniques(7), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
1:49.490Neviscerate
[finish]
Fluffy_Pillow 99.6/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
1:50.493Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:51.497Neviscerate
[finish]
Fluffy_Pillow 81.8/100 82% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:52.501Ebackstab
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:53.506Ebackstab
[build]
Fluffy_Pillow 71.4/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:54.510Neviscerate
[finish]
Fluffy_Pillow 42.2/100 42% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:55.515Ebackstab
[build]
Fluffy_Pillow 61.0/100 61% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:56.938Ebackstab
[build]
Fluffy_Pillow 44.3/100 44% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
1:59.908Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:00.913Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:03.246Rvanish
[stealth_cds]
Combo 3 40.0/100 40% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:03.246Ebackstab
[build]
Fluffy_Pillow 40.0/100 40% energy
2.0/7 29% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(2), premeditation, shadow_techniques, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:05.292Lrupture
[finish]
Fluffy_Pillow 26.0/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:06.295Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(3), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:08.740Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:10.019Hsymbols_of_death
[cds]
Combo 3 14.8/100 15% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:10.024Qshadow_dance
[stealth_cds]
Combo 3 54.9/100 55% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, the_rotten(2), poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:10.024Ksecret_technique
[finish]
Fluffy_Pillow 54.9/100 55% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, the_rotten(2), poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:11.028Dshadowstrike
[build]
Fluffy_Pillow 96.7/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:12.033Mcoup_de_grace
[finish]
Fluffy_Pillow 62.5/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(4), the_rotten, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:13.236Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:14.241Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:15.247Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:16.253Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:17.257Dshadowstrike
[build]
Fluffy_Pillow 85.2/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:18.262Neviscerate
[finish]
Fluffy_Pillow 51.0/100 51% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
2:19.267Ebackstab
[build]
Fluffy_Pillow 69.8/100 70% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
2:20.271Ebackstab
[build]
Fluffy_Pillow 56.6/100 57% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
2:22.101Neviscerate
[finish]
Fluffy_Pillow 44.3/100 44% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
2:23.106Ebackstab
[build]
Fluffy_Pillow 59.1/100 59% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_crit
2:24.214Ksecret_technique
[finish]
Fluffy_Pillow 31.0/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, deeper_daggers, flask_of_alchemical_chaos_crit
2:25.219Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
2:28.045Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
2:30.939Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), bolstering_shadows, flask_of_alchemical_chaos_crit
2:33.925Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, flask_of_alchemical_chaos_crit
2:35.130Ebackstab
[build]
Fluffy_Pillow 73.3/100 73% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:36.136Ebackstab
[build]
Fluffy_Pillow 44.8/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_haste
2:38.561Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:40.597Lrupture
[finish]
Fluffy_Pillow 27.4/100 27% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:41.601Ebackstab
[build]
Fluffy_Pillow 48.8/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:43.758Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), flask_of_alchemical_chaos_haste
2:46.961Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, flask_of_alchemical_chaos_haste
2:49.537Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:50.542Ebackstab
[build]
Fluffy_Pillow 52.3/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:52.599Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:55.338Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:57.944Mcoup_de_grace
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:59.149Ebackstab
[build]
Fluffy_Pillow 79.7/100 80% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:00.153Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 55.6/100 56% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:00.361Ebackstab
[build]
Fluffy_Pillow 62.1/100 62% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:01.365Jflagellation
[cds]
Fluffy_Pillow 34.1/100 34% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:02.371Hsymbols_of_death
[cds]
Combo 3 50.0/100 50% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, flagellation_buff, deeper_daggers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:02.371Qshadow_dance
[stealth_cds]
Combo 3 90.0/100 90% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:02.371Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 90.0/100 90% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:02.371Ksecret_technique
[finish]
Fluffy_Pillow 90.0/100 90% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:03.375Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(9), premeditation, shadow_techniques, the_rotten(2), flagellation_buff(11), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:04.378Neviscerate
[finish]
Fluffy_Pillow 74.9/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(3), the_rotten, flagellation_buff(11), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:05.383Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(3), the_rotten, flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:06.389Ishadow_blades
[cds]
Combo 3 74.4/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:06.389Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:07.394Dshadowstrike
[build]
Fluffy_Pillow 88.6/100 89% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:08.396Neviscerate
[finish]
Fluffy_Pillow 62.4/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(6), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:09.400Dshadowstrike
[build]
Fluffy_Pillow 73.2/100 73% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:10.403Lrupture
[finish]
Fluffy_Pillow 39.0/100 39% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:11.408Ebackstab
[build]
Fluffy_Pillow 67.9/100 68% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:12.413Neviscerate
[finish]
Fluffy_Pillow 38.7/100 39% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:13.417Hsymbols_of_death
[cds]
Combo 3 57.6/100 58% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:13.417Qshadow_dance
[stealth_cds]
Combo 3 97.6/100 98% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:13.417Neviscerate
[finish]
Fluffy_Pillow 97.6/100 98% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:14.422Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:15.426Fcold_blood
[cds]
Combo 3 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form, shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:15.426Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(3), flawless_form, shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:16.430Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:17.435Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:18.439Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:19.643Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:20.647Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:21.651Neviscerate
[finish]
Fluffy_Pillow 84.7/100 85% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:22.657Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
3:23.662Ebackstab
[build]
Fluffy_Pillow 78.8/100 79% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
3:24.666Neviscerate
[finish]
Fluffy_Pillow 49.7/100 50% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
3:25.670Hsymbols_of_death
[cds]
Combo 3 68.5/100 69% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
3:25.670Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:25.670Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:26.674Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:27.679Dshadowstrike
[build]
Fluffy_Pillow 91.7/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:28.682Ksecret_technique
[finish]
Fluffy_Pillow 65.5/100 66% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:29.686Dshadowstrike
[build]
Fluffy_Pillow 94.3/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:30.691Mcoup_de_grace
[finish]
Fluffy_Pillow 68.2/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(5), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:31.896Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:32.900Dshadowstrike
[build]
Fluffy_Pillow 73.8/100 74% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:33.904Neviscerate
[finish]
Fluffy_Pillow 47.7/100 48% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:34.909Ebackstab
[build]
Fluffy_Pillow 58.5/100 59% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:36.224Ebackstab
[build]
Fluffy_Pillow 40.7/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:38.681Neviscerate
[finish]
Fluffy_Pillow 35.1/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
3:39.685Ebackstab
[build]
Fluffy_Pillow 53.8/100 54% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
3:40.901Lrupture
[finish]
Fluffy_Pillow 34.9/100 35% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:41.905Ebackstab
[build]
Fluffy_Pillow 58.7/100 59% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:43.628Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
3:46.421Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
3:47.425Ebackstab
[build]
Fluffy_Pillow 50.0/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:49.586Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:50.591Hsymbols_of_death
[cds]
Combo 3 12.0/100 12% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:50.591Qshadow_dance
[stealth_cds]
Combo 3 52.0/100 52% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
3:50.591Ksecret_technique
[finish]
Fluffy_Pillow 52.0/100 52% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(2), premeditation, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
3:51.593Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(4), flawless_form(3), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
3:52.599Mcoup_de_grace
[finish]
Fluffy_Pillow 59.6/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:53.802Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(8), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:54.805Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:55.808Dshadowstrike
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:56.810Neviscerate
[finish]
Fluffy_Pillow 58.3/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:57.815Dshadowstrike
[build]
Fluffy_Pillow 77.1/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_crit
3:58.819Neviscerate
[finish]
Fluffy_Pillow 50.9/100 51% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:59.823Ebackstab
[build]
Fluffy_Pillow 69.7/100 70% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_crit
4:00.828Neviscerate
[finish]
Fluffy_Pillow 48.5/100 49% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:01.834Ebackstab
[build]
Fluffy_Pillow 59.3/100 59% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
4:03.138Rvanish
[stealth_cds]
Combo 3 41.3/100 41% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
4:03.246Ebackstab
[build]
Fluffy_Pillow 42.5/100 42% energy
3.0/7 43% CP
slice_and_dice, vanish, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), premeditation, shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
4:05.093Ksecret_technique
[finish]
Fluffy_Pillow 30.3/100 30% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:06.098Ebackstab
[build]
Fluffy_Pillow 50.1/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form, shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:08.053Neviscerate
[finish]
Fluffy_Pillow 35.1/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:09.058Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:12.058Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
4:15.272Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:17.114Lrupture
[finish]
Fluffy_Pillow 25.8/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:18.119Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:20.439Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:23.264Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form(3), shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:25.793Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form(2), shadow_techniques(3), nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:26.998Ebackstab
[build]
Fluffy_Pillow 78.4/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(7), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:28.004Ebackstab
[build]
Fluffy_Pillow 53.3/100 53% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:29.730Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:30.734Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:30.734Ebackstab
[build]
Fluffy_Pillow 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(6), shadow_techniques(2), deeper_daggers, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:32.113Jflagellation
[cds]
Fluffy_Pillow 26.2/100 26% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(6), deeper_daggers, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:33.118Hsymbols_of_death
[cds]
Combo 3 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(5), shadow_techniques, flagellation_buff, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
4:33.118Qshadow_dance
[stealth_cds]
Combo 3 81.1/100 81% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form(5), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
4:33.118Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 81.1/100 81% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form(5), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
4:33.118Ksecret_technique
[finish]
Fluffy_Pillow 81.1/100 81% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form(5), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:34.124Dshadowstrike
[build]
Fluffy_Pillow 91.6/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(6), premeditation, shadow_techniques, the_rotten(2), flagellation_buff(7), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:35.130Neviscerate
[finish]
Fluffy_Pillow 73.1/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(7), shadow_techniques(5), the_rotten, flagellation_buff(7), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:36.134Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, escalating_blade, flawless_form(7), shadow_techniques(7), the_rotten, flagellation_buff(17), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:37.138Ishadow_blades
[cds]
Combo 3 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(2), flawless_form(8), shadow_techniques(3), flagellation_buff(17), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:37.138Neviscerate
[finish]
Fluffy_Pillow 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(2), flawless_form(8), shadow_techniques(3), flagellation_buff(17), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:38.143Dshadowstrike
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form(3), shadow_techniques(5), flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:39.145Neviscerate
[finish]
Fluffy_Pillow 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form(3), shadow_techniques(7), flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:40.149Neviscerate
[finish]
Fluffy_Pillow 76.8/100 77% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form(3), shadow_techniques(2), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:41.156Ebackstab
[build]
Fluffy_Pillow 95.6/100 96% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:42.160Hsymbols_of_death
[cds]
Combo 3 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:42.160Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(6), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:42.160Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(6), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:43.163Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(10), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:44.169Neviscerate
[finish]
Fluffy_Pillow 65.9/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(4), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:45.173Fcold_blood
[cds]
Combo 3 91.7/100 92% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:45.173Ksecret_technique
[finish]
Fluffy_Pillow 91.7/100 92% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:46.177Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:47.180Mcoup_de_grace
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:48.385Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:49.389Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(11), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:50.396Lrupture
[finish]
Fluffy_Pillow 84.7/100 85% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:51.400Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:52.403Neviscerate
[finish]
Fluffy_Pillow 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(10), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
4:53.408Neviscerate
[finish]
Fluffy_Pillow 89.7/100 90% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
4:54.412Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
4:55.417Neviscerate
[finish]
Fluffy_Pillow 78.8/100 79% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
4:56.422Ebackstab
[build]
Fluffy_Pillow 84.7/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520340936324701238249
Intellect12000012360120000
Spirit00000
Health681872064940200
Energy1001000
Combo Points770
Spell Power12360120000
Crit20.03%20.03%5620
Haste2.35%2.79%1843
Versatility29.68%27.06%21108
Attack Power6162857457938
Mastery71.31%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 638.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Finger2 Ring of Dun Algaz
ilevel: 639, stats: { +13,614 Sta, +2,102 Crit, +4,028 Vers }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 3"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
finger2=ring_of_dun_algaz,id=133287,bonus_id=10390/6652/10394/10878/10383/10299/11342/10255
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=637.81
# gear_agility=36181
# gear_stamina=238249
# gear_attack_power=938
# gear_crit_rating=5510
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=20694
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Messerknecht : 1,466,489 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,466,489.31,466,489.32,902.7 / 0.198%198,325.9 / 13.5%49,024.5
Resource Out In Waiting APM Active
Energy29.929.711.63%57.2100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Messerknecht1,466,489
Auto Attack 0 (70,321)0.0% (4.8%)3.9122.45s5,372,9180

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 46,9883.2%355.40.98s39,68240,576Direct355.438,38477,38639,68819.4%16.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage355.38355.380.000.000.000.97800.000014,102,295.8718,399,164.7923.35%40,576.3140,576.31
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.32%228.5816929338,383.7923,68464,32238,396.1236,79740,5328,773,19811,447,32623.36%
crit19.38%68.884010777,385.5450,126128,66977,430.4369,13088,2105,329,0986,951,83923.34%
miss16.30%57.9333920.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,3331.6%354.80.98s19,74420,121Direct354.819,12238,51219,74619.4%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage354.76354.760.000.000.000.98120.00007,004,333.379,138,650.8623.35%20,121.3820,121.38
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.24%227.9016530119,121.7411,89632,03019,126.6518,18820,0614,357,3785,685,42523.36%
crit19.37%68.733510938,511.5223,37564,15538,530.0733,86542,8992,646,9553,453,22623.35%
miss16.38%58.1335960.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,2342.1%75.63.70s120,307119,768Direct75.672,895188,652120,28841.0%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.5975.590.000.000.001.00450.00009,093,754.3511,898,211.9823.57%119,768.13119,768.13
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit59.04%44.63276772,895.2457,139137,86572,882.6568,82377,0143,253,0194,258,01523.59%
crit40.96%30.961553188,651.59125,912421,199188,761.19175,129210,9895,840,7357,640,19723.57%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.59

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 90,160 (128,633)6.2% (8.8%)13.422.21s2,892,2672,401,237Direct40.0 (78.5)519,2541,054,662676,89529.4% (29.4%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.3640.000.000.000.001.20450.000027,071,095.6935,243,083.9323.19%2,401,236.522,401,236.52
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.56%28.221243519,254.25119,7431,948,971519,460.69335,041724,24014,658,90419,085,33823.20%
crit29.44%11.781231,054,661.77239,8463,711,1891,053,164.78483,5871,869,38712,412,19216,157,74623.20%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.35
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 38,4732.6%0.00.00s00Direct38.5231,228464,939300,11329.5%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.500.000.000.000.00000.000011,555,195.0011,555,195.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.55%27.161440231,227.5154,533845,533231,467.05159,461321,2116,280,5766,280,5760.00%
crit29.45%11.34224464,939.44114,3451,646,281465,296.48217,209779,2835,274,6195,274,6190.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (20,069)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 20,0691.4%22.412.83s269,4480Direct22.4269,5790269,5790.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.3622.360.000.000.000.00000.00006,026,183.596,026,183.590.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.361141269,578.66260,578314,635269,546.64262,871279,6546,026,1846,026,1840.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 256,222 (366,371)17.5% (25.0%)68.84.38s1,597,9031,590,761Direct68.8 (136.3)854,5591,759,7261,117,93929.1% (29.1%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.7868.780.000.000.001.00450.000076,866,036.4299,988,482.2823.13%1,590,760.881,590,760.88
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.90%48.772965854,558.68210,8622,390,359854,459.78696,3921,001,64741,656,42354,190,54623.13%
crit29.10%20.028341,759,726.10422,3575,205,0531,758,984.101,099,0072,433,24835,209,61445,797,93623.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.79

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 110,1497.5%67.54.45s489,5410Direct67.5376,763765,708489,79529.1%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.5067.500.000.000.000.00000.000033,044,405.3033,044,405.300.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.94%47.893265376,762.73100,5271,036,320376,753.70311,483442,09218,037,33118,037,3310.00%
crit29.06%19.61834765,707.92201,3562,258,138764,768.89483,9971,079,84715,007,07515,007,0750.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,033 (20,962)0.1% (1.4%)3.791.20s1,696,2591,688,841Direct3.7 (27.6)69,809139,53283,48119.6% (19.7%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000309,738.93309,738.930.00%1,688,841.181,688,841.18
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.45%2.990469,809.4160,925139,19369,444.65098,280208,459208,4590.00%
crit19.55%0.7304139,532.40122,033255,48376,988.700255,483101,280101,2800.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 19,9291.4%0.00.00s00Direct23.8209,815418,673251,08519.8%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.840.000.000.000.00000.00005,986,260.995,986,260.990.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.22%19.13928209,814.6077,405438,883209,616.69170,889243,6924,012,8604,012,8600.00%
crit19.78%4.71013418,672.77159,955891,011414,594.640772,8351,973,4011,973,4010.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,2040.8%0.00.00s00Direct283.810,79221,74712,90919.3%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00283.780.000.000.000.00000.00003,663,168.543,663,168.540.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.67%228.9315930710,791.647,51417,55710,793.5910,16011,5582,470,4562,470,4560.00%
crit19.33%54.85299321,747.0215,05135,11721,753.8819,16424,7641,192,7121,192,7120.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 98,854 (117,053)6.7% (8.0%)9.631.28s3,672,7413,656,515Periodic167.6 (335.2)135,733281,027177,08228.5% (28.5%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.570.00167.62167.627.091.00451.740529,676,192.7729,676,192.770.00%116,600.233,656,515.21
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.55%119.9383155135,732.57138428,858135,767.95119,895151,68816,276,55116,276,5510.00%
crit28.45%47.692373281,026.80271834,848281,160.13221,713345,74913,399,64213,399,6420.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.57
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,1991.2%167.61.76s32,5910Periodic167.624,96151,71932,59028.5%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.620.000.00167.620.000.00000.00005,462,918.405,462,918.400.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.47%119.808616424,961.319,67178,63624,968.7022,26827,7592,989,9622,989,9620.00%
crit28.53%47.82257851,718.9519,371153,07951,789.5239,99264,3672,472,9562,472,9560.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (272,089)0.0% (18.6%)16.019.07s5,092,8355,070,051

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.030.000.000.000.001.00450.00000.000.000.00%5,070,050.575,070,050.57

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.03
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,8854.8%0.00.00s00Direct16.0683,7182,123,1091,307,99643.4%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.030.000.000.000.00000.000020,965,716.7527,329,338.7923.28%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.64%9.08215683,718.00150,6161,673,124683,950.07350,4511,184,5616,209,3168,115,70223.49%
crit43.36%6.953142,123,108.56331,5214,079,1602,163,071.361,352,3623,289,86214,756,40119,213,63723.19%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 202,20413.8%0.00.00s00Direct32.0995,7773,037,2651,898,71844.2%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.970.000.000.000.00000.000060,687,447.6660,687,447.660.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.78%17.831028995,777.27221,6202,419,536996,763.58679,7411,290,61617,751,01117,751,0110.00%
crit44.22%14.147243,037,265.10445,2515,898,9503,065,889.972,154,4814,131,73042,936,43742,936,4370.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (104,658)0.0% (7.1%)3.790.74s8,604,1300

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.66
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 104,6587.1%384.91.20s81,6550Periodic384.981,652081,6520.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage384.860.000.00384.860.000.00000.000031,425,629.4831,425,629.480.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%384.8629446981,652.411511,180,50681,700.7268,67495,65431,425,62931,425,6290.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6939.66
  • base_dd_max:6939.66
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 117,8038.0%52.45.81s673,375670,373Direct52.4280,865915,927673,51261.8%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.4452.440.000.000.001.00450.000035,313,909.0846,042,929.1023.30%670,373.00670,373.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.18%20.021032280,864.51130,261411,785280,863.48255,684313,7075,623,9677,327,42623.25%
crit61.82%32.422146915,927.26287,0431,411,743916,649.60847,7191,008,11429,689,94338,715,50323.31%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.43

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,7620.3%2.367.94s484,2580Direct2.3400,753801,742484,34520.9%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.342.340.000.000.000.00000.00001,131,664.831,131,664.830.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.13%1.8507400,752.56377,346471,474339,637.060468,334740,781740,7810.00%
crit20.87%0.4905801,741.66755,824945,512316,189.210945,512390,884390,8840.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8130.1%2.275.79s108,6850Direct2.291,368183,519108,55718.8%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.252.250.000.000.000.00000.0000244,227.36244,227.360.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.20%1.820891,368.1283,958118,09177,365.480118,091166,676166,6760.00%
crit18.80%0.4204183,519.41168,168228,17464,456.840228,17477,55177,5510.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67871.49
  • base_dd_max:67871.49
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 46,8693.2%19.115.34s739,7710Periodic107.5131,2230131,2230.0%0.0%71.5%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.050.00107.47107.4712.040.00002.000014,092,820.7714,092,820.770.00%65,569.350.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.4757159131,222.8260,995221,345130,124.7370,039174,01414,092,82114,092,8210.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 64,6054.4%32.69.29s595,7050Direct32.6498,824999,148595,71719.3%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage32.6032.600.000.000.000.00000.000019,418,309.0519,418,309.050.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.66%26.291146498,823.55453,001862,662498,675.77464,736543,96413,117,02113,117,0210.00%
crit19.34%6.30016999,147.66907,3601,742,032996,061.0201,332,5316,301,2886,301,2880.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,5480.3%2.478.30s573,8480Direct2.4480,999960,617573,85019.4%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.372.370.000.000.000.00000.00001,361,353.691,361,353.690.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.62%1.9108480,999.30452,539573,919410,611.170551,448919,898919,8980.00%
crit19.38%0.4606960,617.04906,4361,128,424351,709.7001,128,424441,456441,4560.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 85,4945.8%58.45.15s439,6620Direct58.4367,466739,669439,71919.4%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.3758.370.000.000.000.00000.000025,664,837.4333,524,425.1523.44%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.60%47.052964367,465.64220,828567,016367,605.89330,623396,80817,287,51422,585,62123.46%
crit19.40%11.32224739,669.15442,3191,118,618740,294.02550,758930,7428,377,32310,938,80423.42%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Messerknecht
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.57s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.550.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.56
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.792.12s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.730.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.411.31s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.360.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.376.70s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.310.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.366.37s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.320.0054.510.000.280.00000.83520.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5310.65s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.490.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.48
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 99.03.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.970.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.470.60s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.410.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.18s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.330.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.33
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.275.79s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.252.250.000.000.000.00000.00000.001,540,810.070.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.25090.00000.000001,540,81090.69%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8130.1%2.275.79s108,6850Direct2.291,368183,519108,55718.8%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.252.250.000.000.000.00000.0000244,227.36244,227.360.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.20%1.820891,368.1283,958118,09177,365.480118,091166,676166,6760.00%
crit18.80%0.4204183,519.41168,168228,17464,456.840228,17477,55177,5510.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67871.49
  • base_dd_max:67871.49
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.321.42s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.30
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.45s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.93
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.274.04s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.240.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1593.0170.2s0.5s280.6s99.94%100.00%583.4 (583.4)0.1

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:41.5s / 338.7s
  • trigger_min/max:0.0s / 4.7s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 359.9s
  • uptime_min/max:99.23% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.22%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.17%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.14%
  • acrobatic_strikes_10:98.35%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.6116.9s3.5s128.4s97.32%0.00%74.3 (77.1)1.3

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.1s / 281.9s
  • trigger_min/max:1.0s / 45.9s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 357.6s
  • uptime_min/max:86.49% / 99.44%

Stack Uptimes

  • alacrity_1:2.95%
  • alacrity_2:2.16%
  • alacrity_3:1.79%
  • alacrity_4:1.62%
  • alacrity_5:88.81%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.50%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.019.0s19.0s6.9s37.00%100.00%0.0 (0.0)15.7

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 55.6s
  • trigger_min/max:9.2s / 55.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:32.37% / 40.89%

Stack Uptimes

  • bolstering_shadows_1:37.00%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.1s0.00%1.40%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:81.9s / 106.4s
  • trigger_min/max:81.9s / 106.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 0.2s
  • uptime_min/max:0.00% / 0.07%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.30.0130.1s108.3s4.4s1.84%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.6s
  • trigger_min/max:90.0s / 237.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.1s
  • uptime_min/max:0.00% / 7.95%

Stack Uptimes

  • cryptic_instructions_1:1.84%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.348.123.1s23.1s8.2s36.45%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 70.1s
  • trigger_min/max:8.0s / 70.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.80% / 39.48%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.54%
  • danse_macabre_3:6.58%
  • danse_macabre_4:16.44%
  • danse_macabre_5:8.84%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.540.7s3.7s35.6s90.09%95.66%74.5 (74.5)6.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 182.8s
  • trigger_min/max:1.0s / 40.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 162.5s
  • uptime_min/max:80.95% / 97.17%

Stack Uptimes

  • deeper_daggers_1:90.09%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.019.0s19.0s3.4s18.39%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 55.6s
  • trigger_min/max:9.2s / 55.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:14.90% / 22.06%

Stack Uptimes

  • disorienting_strikes_1:12.21%
  • disorienting_strikes_2:6.18%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0128.9s108.6s4.0s1.64%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.8s
  • trigger_min/max:90.0s / 189.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.4s
  • uptime_min/max:0.00% / 6.70%

Stack Uptimes

  • errant_manaforge_emission_1:1.64%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.244.222.0s5.2s17.3s81.70%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 61.1s
  • trigger_min/max:1.0s / 24.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.8s
  • uptime_min/max:63.64% / 92.66%

Stack Uptimes

  • escalating_blade_1:24.95%
  • escalating_blade_2:22.19%
  • escalating_blade_3:22.54%
  • escalating_blade_4:12.01%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.6s90.6s14.7s18.16%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:82.8s / 180.1s
  • trigger_min/max:82.8s / 180.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s
  • uptime_min/max:13.41% / 20.82%

Stack Uptimes

  • ethereal_powerlink_1:18.16%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.284.6s71.2s15.4s10.64%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4576.07

Trigger Details

  • interval_min/max:15.1s / 310.9s
  • trigger_min/max:0.9s / 310.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.6s
  • uptime_min/max:0.00% / 37.84%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.64%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.8s14.62%0.00%14.3 (96.2)3.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 97.8s
  • trigger_min/max:1.0s / 87.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:13.00% / 16.90%

Stack Uptimes

  • flagellation_buff_1:1.33%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.77%
  • flagellation_buff_9:0.62%
  • flagellation_buff_10:0.55%
  • flagellation_buff_11:0.46%
  • flagellation_buff_12:0.01%
  • flagellation_buff_13:0.03%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.01%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.05%
  • flagellation_buff_19:0.43%
  • flagellation_buff_20:0.37%
  • flagellation_buff_21:0.31%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.20%
  • flagellation_buff_25:0.84%
  • flagellation_buff_26:0.36%
  • flagellation_buff_27:0.19%
  • flagellation_buff_28:0.20%
  • flagellation_buff_29:0.00%
  • flagellation_buff_30:7.10%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.18%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.6s / 97.8s
  • trigger_min/max:78.6s / 97.8s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 12.0s
  • uptime_min/max:12.42% / 16.26%

Stack Uptimes

  • flagellation_persist_11:0.00%
  • flagellation_persist_16:0.00%
  • flagellation_persist_23:0.00%
  • flagellation_persist_30:14.18%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.7113.8s77.4s35.7s25.32%0.00%3.0 (3.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 315.5s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 180.0s
  • uptime_min/max:0.00% / 74.13%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.34%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6110.4s75.9s35.4s25.10%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.5s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 180.0s
  • uptime_min/max:0.00% / 75.19%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.10%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.7s75.8s35.8s25.09%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.9s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 77.53%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.09%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.8s78.2s34.7s24.49%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 180.0s
  • uptime_min/max:0.00% / 74.10%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.49%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.80.040.1s3.4s60.5s95.43%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.60%
  • flawless_form_2:8.74%
  • flawless_form_3:11.76%
  • flawless_form_4:9.70%
  • flawless_form_5:2.69%
  • flawless_form_6:4.44%
  • flawless_form_7:5.98%
  • flawless_form_8:11.29%
  • flawless_form_9:18.47%
  • flawless_form_10:8.97%
  • flawless_form_11:1.44%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.16%
  • flawless_form_16:0.09%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)2.00.286.4s72.0s16.9s11.19%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.7s / 337.0s
  • trigger_min/max:0.1s / 322.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 49.5s
  • uptime_min/max:0.00% / 39.78%

Stack Uptimes

  • nascent_empowerment_Crit_1:11.19%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.289.8s76.1s16.9s10.90%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.7s / 302.5s
  • trigger_min/max:0.1s / 302.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 53.6s
  • uptime_min/max:0.00% / 41.49%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.91%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.284.2s71.0s16.7s10.74%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.0s / 325.1s
  • trigger_min/max:0.5s / 325.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.6s
  • uptime_min/max:0.00% / 39.92%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.74%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.284.9s71.8s16.7s10.45%0.00%0.2 (0.2)1.1

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.7s / 320.7s
  • trigger_min/max:0.2s / 320.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 53.5s
  • uptime_min/max:0.00% / 38.15%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.45%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.90.422.0s21.3s3.7s16.96%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 84.6s
  • trigger_min/max:1.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 27.8s
  • uptime_min/max:8.42% / 27.18%

Stack Uptimes

  • poised_shadows_1:16.96%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.30.017.9s18.9s1.1s2.62%11.20%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 67.2s
  • trigger_min/max:1.0s / 67.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.78% / 4.50%

Stack Uptimes

  • premeditation_1:2.62%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0128.5s107.5s4.0s1.68%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 335.1s
  • trigger_min/max:90.0s / 187.8s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 11.6s
  • uptime_min/max:0.00% / 8.05%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.68%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.10.286.1s73.6s15.4s10.67%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:23996.43

Trigger Details

  • interval_min/max:15.0s / 318.4s
  • trigger_min/max:1.0s / 318.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 52.4s
  • uptime_min/max:0.00% / 38.16%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.67%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.70.090.9s90.9s15.8s19.16%17.11%0.0 (0.0)3.5

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.6s
  • trigger_min/max:90.0s / 97.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:16.75% / 21.91%

Stack Uptimes

  • shadow_blades_1:19.16%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.1s23.1s8.2s36.45%100.00%0.0 (0.0)13.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 70.1s
  • trigger_min/max:8.0s / 70.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.80% / 39.48%

Stack Uptimes

  • shadow_dance_1:36.45%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.2139.14.4s1.4s3.5s79.23%95.45%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 43.9s
  • trigger_min/max:0.5s / 6.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.5s
  • uptime_min/max:72.34% / 87.04%

Stack Uptimes

  • shadow_techniques_1:20.50%
  • shadow_techniques_2:20.93%
  • shadow_techniques_3:9.35%
  • shadow_techniques_4:10.63%
  • shadow_techniques_5:6.04%
  • shadow_techniques_6:5.85%
  • shadow_techniques_7:2.57%
  • shadow_techniques_8:2.33%
  • shadow_techniques_9:0.52%
  • shadow_techniques_10:0.44%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.01%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s298.4s99.32%87.67%99.0 (99.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.0s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.60.0112.9s102.1s9.9s1.88%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:8.0s / 329.4s
  • trigger_min/max:1.0s / 285.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 19.9s
  • uptime_min/max:0.00% / 15.11%

Stack Uptimes

  • storm_sewers_citrine_1:1.88%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.0117.4s102.7s10.0s1.90%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.0s / 323.0s
  • trigger_min/max:2.3s / 323.0s
  • trigger_pct:100.00%
  • duration_min/max:1.4s / 19.2s
  • uptime_min/max:0.00% / 16.40%

Stack Uptimes

  • storm_sewers_citrine_1:1.90%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.60.0107.9s97.2s9.9s2.00%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.1s / 314.3s
  • trigger_min/max:1.0s / 284.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 17.0s
  • uptime_min/max:0.00% / 13.66%

Stack Uptimes

  • storm_sewers_citrine_1:2.00%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.00.283.7s70.7s15.4s10.31%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1430.02
  • stat:haste_rating
  • amount:1430.02
  • stat:mastery_rating
  • amount:1430.02
  • stat:versatility_rating
  • amount:1430.02

Trigger Details

  • interval_min/max:15.1s / 313.5s
  • trigger_min/max:1.0s / 313.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.3s
  • uptime_min/max:0.00% / 36.56%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.31%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.30.021.4s21.4s2.3s11.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 65.7s
  • trigger_min/max:3.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.4s
  • uptime_min/max:9.04% / 15.48%

Stack Uptimes

  • supercharge_1_1:11.00%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.30.021.3s21.3s1.0s2.03%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 65.7s
  • trigger_min/max:1.2s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.4s
  • uptime_min/max:0.56% / 7.29%

Stack Uptimes

  • supercharge_2_1:2.03%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.4s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 2.2s
  • uptime_min/max:0.00% / 0.68%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s1.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 1.0s
  • uptime_min/max:0.00% / 0.30%

Stack Uptimes

  • supercharge_4_1:0.00%

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.46.943.7s21.3s24.6s61.13%100.00%6.9 (6.9)6.9

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.1s / 96.1s
  • trigger_min/max:1.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:57.45% / 65.63%

Stack Uptimes

  • symbols_of_death_1:61.13%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.8s307.8s27.6s13.43%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.0s
  • trigger_min/max:300.0s / 329.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.95% / 18.11%

Stack Uptimes

  • tempered_potion_1:13.43%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.69%3.79%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.40% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.69%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.30.021.4s21.3s2.9s13.80%22.27%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:4.0s / 65.7s
  • trigger_min/max:1.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.3s
  • uptime_min/max:11.35% / 16.96%

Stack Uptimes

  • the_rotten_1:10.75%
  • the_rotten_2:3.05%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.3s122.3s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.3s
  • trigger_min/max:120.0s / 136.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.38%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.076.1s43.2s14.7s0.46%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4579.92

Trigger Details

  • interval_min/max:22.7s / 121.5s
  • trigger_min/max:3.0s / 121.5s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 29.4s
  • uptime_min/max:0.00% / 14.38%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.52%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)1.90.284.6s72.2s15.5s9.97%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5694.82

Trigger Details

  • interval_min/max:15.2s / 318.0s
  • trigger_min/max:1.0s / 318.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 43.6s
  • uptime_min/max:0.00% / 39.86%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:9.97%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.827.078.05.9s0.7s66.2s
Skyfury (Off Hand)49.628.076.06.0s0.7s61.1s
Supercharger secret_technique12.58.016.023.6s9.2s90.0s
Cold Blood secret_technique3.63.04.090.7s81.9s106.4s
Supercharger rupture0.20.02.0181.0s38.3s289.8s
Supercharger coup_de_grace2.80.08.075.0s9.2s322.3s
Supercharger eviscerate12.97.020.023.3s1.0s152.0s
CP Spent During Flagellation202.1127.0251.011.2s1.0s90.0s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.40%6.26%12.75%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Messerknecht
Energy RegenEnergy1,438.603,040.7934.07%2.11399.8911.62%
Improved AmbushCombo Points52.4333.664.59%0.6418.7735.80%
PremeditationCombo Points17.2457.197.79%3.3263.5052.61%
Relentless StrikesEnergy107.744,287.0748.04%39.79124.512.82%
Shadow BladesCombo Points21.93113.9015.52%5.1917.6813.43%
Shadow TechniquesEnergy361.161,238.3413.88%3.43206.2914.28%
Shadow TechniquesCombo Points85.82242.0032.97%2.820.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.33107.3114.62%7.000.000.00%
BackstabCombo Points75.5975.1910.24%0.990.400.53%
ShadowstrikeCombo Points52.43104.8314.28%2.000.040.03%
Symbols of DeathEnergy14.30357.824.01%25.02214.2537.45%
Usage Type Count Total Tot% Avg RPE APR
Messerknecht
BackstabEnergy75.593,023.5233.68%40.0040.003,007.67
Coup de GraceEnergy13.35467.335.21%35.0034.9982,652.64
Coup de GraceCombo Points13.3591.2112.49%6.836.83423,496.77
EviscerateEnergy68.792,407.5826.82%35.0035.0045,651.88
EviscerateCombo Points68.79468.5564.18%6.816.81234,577.86
RuptureEnergy9.57239.252.66%25.0025.01146,869.68
RuptureCombo Points9.5765.438.96%6.846.84537,083.61
Secret TechniqueEnergy16.03480.985.36%30.0030.00169,764.58
Secret TechniqueCombo Points16.03104.9214.37%6.546.54778,277.95
ShadowstrikeEnergy52.432,359.4926.28%45.0044.9914,966.75
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.7129.89944.745.90.1100.0
Combo Points0.02.442.43100.34.00.07.0

Statistics & Data Analysis

Fight Length
Messerknecht Fight Length
Count 1214
Mean 300.42
Minimum 240.02
Maximum 359.88
Spread ( max - min ) 119.87
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
Messerknecht Damage Per Second
Count 1214
Mean 1466489.34
Minimum 1325745.72
Maximum 1640870.64
Spread ( max - min ) 315124.92
Range [ ( max - min ) / 2 * 100% ] 10.74%
Standard Deviation 51602.4779
5th Percentile 1381801.79
95th Percentile 1550440.87
( 95th Percentile - 5th Percentile ) 168639.07
Mean Distribution
Standard Deviation 1481.0210
95.00% Confidence Interval ( 1463586.60 - 1469392.09 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4757
0.1 Scale Factor Error with Delta=300 22731327
0.05 Scale Factor Error with Delta=300 90925307
0.01 Scale Factor Error with Delta=300 2273132661
Priority Target DPS
Messerknecht Priority Target Damage Per Second
Count 1214
Mean 1466489.34
Minimum 1325745.72
Maximum 1640870.64
Spread ( max - min ) 315124.92
Range [ ( max - min ) / 2 * 100% ] 10.74%
Standard Deviation 51602.4779
5th Percentile 1381801.79
95th Percentile 1550440.87
( 95th Percentile - 5th Percentile ) 168639.07
Mean Distribution
Standard Deviation 1481.0210
95.00% Confidence Interval ( 1463586.60 - 1469392.09 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4757
0.1 Scale Factor Error with Delta=300 22731327
0.05 Scale Factor Error with Delta=300 90925307
0.01 Scale Factor Error with Delta=300 2273132661
DPS(e)
Messerknecht Damage Per Second (Effective)
Count 1214
Mean 1466489.34
Minimum 1325745.72
Maximum 1640870.64
Spread ( max - min ) 315124.92
Range [ ( max - min ) / 2 * 100% ] 10.74%
Damage
Messerknecht Damage
Count 1214
Mean 440167495.31
Minimum 333601706.75
Maximum 537560159.52
Spread ( max - min ) 203958452.77
Range [ ( max - min ) / 2 * 100% ] 23.17%
DTPS
Messerknecht Damage Taken Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Messerknecht Healing Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Messerknecht Healing Per Second (Effective)
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Messerknecht Heal
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Messerknecht Healing Taken Per Second
Count 1214
Mean 3044.72
Minimum 0.00
Maximum 10657.41
Spread ( max - min ) 10657.41
Range [ ( max - min ) / 2 * 100% ] 175.01%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.43 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.59 backstab
actions.cds
# count action,conditions
F 3.56 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.48 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.30 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.66 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.03 secret_technique,if=variable.secret
L 9.57 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.35 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.79 eviscerate
actions.item
# count action,conditions
O 3.73 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.71 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.33 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.93 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNDMNDNHNDFKNENENNEENEHQMDKDNDNDLENENHQDNDKDMDNENEENEEHQNDKDNDMDLENEENENEEENEENEOEJHQPKDNDIMDNDLENQFKHDNDNDNNENNEENEENEELRDHQKDMNDNDNEENEEEKEELEEEMEENEEEOLEEJHQPKDINDNDMNENHQDFKNDNDNDNNEEHQNDKDNDMDLEENEENEENHQDKDMDNDNEELEENEEKRDMENEEENEEELOEJHQPKDIMDNNHDNQDNKDNNDNNEMEN

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, cryptic_instructions
0:01.003Gpotion
[cds]
Fluffy_Pillow 68.3/100 68% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, cryptic_instructions
0:01.003Jflagellation
[cds]
Fluffy_Pillow 68.3/100 68% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, cryptic_instructions, tempered_potion
0:02.007Neviscerate
[finish]
Fluffy_Pillow 86.2/100 86% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(4), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, cryptic_instructions, tempered_potion
0:03.012Rvanish
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(5), alacrity, flawless_form, shadow_techniques, the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:03.012Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(5), alacrity, flawless_form, premeditation, shadow_techniques, the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:04.017Lrupture
[finish]
Fluffy_Pillow 69.0/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(6), alacrity, flawless_form(2), shadow_techniques, the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:05.021Hsymbols_of_death
[cds]
Messerknecht 97.2/100 97% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(8), alacrity(2), flawless_form(2), shadow_techniques(2), the_first_dance, flagellation_buff(15), deeper_daggers, cryptic_instructions, tempered_potion
0:05.021Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(8), alacrity(2), supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(2), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, cryptic_instructions, tempered_potion
0:05.021Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(8), alacrity(2), supercharge_1, supercharge_2, flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, cryptic_instructions, tempered_potion
0:05.021Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(8), alacrity(2), supercharge_1, supercharge_2, flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.026Ishadow_blades
[cds]
Messerknecht 77.2/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.026Ksecret_technique
[finish]
Fluffy_Pillow 77.2/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.032Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:08.036Neviscerate
[finish]
Fluffy_Pillow 77.3/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, flawless_form(4), shadow_techniques(6), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:09.041Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(4), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:10.045Mcoup_de_grace
[finish]
Fluffy_Pillow 77.4/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(5), shadow_techniques(10), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:11.250Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:12.254Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:13.260Neviscerate
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(9), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.263Hsymbols_of_death
[cds]
Messerknecht 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.263Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:15.266Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:16.271Fcold_blood
[cds]
Messerknecht 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:16.271Ksecret_technique
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:17.275Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(10), shadow_techniques, the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:18.280Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(9), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:19.284Neviscerate
[finish]
Fluffy_Pillow 90.6/100 91% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:20.286Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, tempered_potion
0:21.291Neviscerate
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, tempered_potion
0:22.297Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, tempered_potion
0:23.301Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, tempered_potion
0:24.305Ebackstab
[build]
Fluffy_Pillow 82.6/100 83% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, tempered_potion
0:25.310Neviscerate
[finish]
Fluffy_Pillow 65.2/100 65% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, tempered_potion
0:26.315Ebackstab
[build]
Fluffy_Pillow 87.8/100 88% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, tempered_potion
0:27.319Hsymbols_of_death
[cds]
Messerknecht 70.4/100 70% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, tempered_potion
0:27.319Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, tempered_potion
0:27.319Mcoup_de_grace
[finish]
Fluffy_Pillow 100.0/100 100% energy
6.0/7 86% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, tempered_potion
0:28.524Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, nascent_empowerment_Vers, tempered_potion
0:29.529Ksecret_technique
[finish]
Fluffy_Pillow 69.6/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, nascent_empowerment_Vers, tempered_potion
0:30.536Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, nascent_empowerment_Vers, tempered_potion
0:31.539Neviscerate
[finish]
Fluffy_Pillow 77.3/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, nascent_empowerment_Vers
0:32.542Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(8), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, nascent_empowerment_Vers
0:33.545Neviscerate
[finish]
Fluffy_Pillow 77.0/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, nascent_empowerment_Vers
0:34.548Dshadowstrike
[build]
Fluffy_Pillow 99.0/100 99% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Mastery, nascent_empowerment_Vers
0:35.554Lrupture
[finish]
Fluffy_Pillow 68.1/100 68% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Mastery, nascent_empowerment_Vers
0:36.559Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(6), deeper_daggers, windsingers_runed_citrine_Mastery, nascent_empowerment_Vers
0:37.565Neviscerate
[finish]
Fluffy_Pillow 82.1/100 82% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Mastery, nascent_empowerment_Vers
0:38.571Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(6), deeper_daggers, nascent_empowerment_Vers
0:39.575Neviscerate
[finish]
Fluffy_Pillow 82.0/100 82% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers
0:40.579Hsymbols_of_death
[cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers
0:40.579Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers
0:40.579Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers
0:41.584Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers
0:42.588Dshadowstrike
[build]
Fluffy_Pillow 99.6/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers
0:43.592Ksecret_technique
[finish]
Fluffy_Pillow 73.4/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Vers
0:44.597Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Vers
0:45.600Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:46.804Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(6), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:47.809Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:48.815Ebackstab
[build]
Fluffy_Pillow 93.1/100 93% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
0:49.819Neviscerate
[finish]
Fluffy_Pillow 72.1/100 72% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
0:50.824Ebackstab
[build]
Fluffy_Pillow 91.1/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
0:51.829Ebackstab
[build]
Fluffy_Pillow 70.1/100 70% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
0:52.833Neviscerate
[finish]
Fluffy_Pillow 41.1/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
0:53.838Ebackstab
[build]
Fluffy_Pillow 60.7/100 61% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
0:55.063Ebackstab
[build]
Fluffy_Pillow 42.8/100 43% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
0:56.689Hsymbols_of_death
[cds]
Messerknecht 29.5/100 30% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
0:56.689Qshadow_dance
[stealth_cds]
Messerknecht 69.5/100 70% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(7), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
0:56.689Neviscerate
[finish]
Fluffy_Pillow 69.5/100 70% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(7), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
0:57.694Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
0:58.699Ksecret_technique
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
0:59.704Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:00.708Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:01.712Dshadowstrike
[build]
Fluffy_Pillow 94.1/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(8), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:02.716Mcoup_de_grace
[finish]
Fluffy_Pillow 60.5/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:03.922Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(8), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:04.926Lrupture
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:05.930Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(8), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:06.935Neviscerate
[finish]
Fluffy_Pillow 71.3/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:07.939Ebackstab
[build]
Fluffy_Pillow 90.7/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:08.943Ebackstab
[build]
Fluffy_Pillow 70.0/100 70% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:09.947Neviscerate
[finish]
Fluffy_Pillow 49.3/100 49% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:10.953Ebackstab
[build]
Fluffy_Pillow 68.7/100 69% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:11.958Neviscerate
[finish]
Fluffy_Pillow 48.0/100 48% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:12.962Ebackstab
[build]
Fluffy_Pillow 54.3/100 54% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
1:15.080Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
1:18.098Ebackstab
[build]
Fluffy_Pillow 41.5/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
1:20.883Neviscerate
[finish]
Fluffy_Pillow 35.4/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
1:21.888Ebackstab
[build]
Fluffy_Pillow 50.2/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
1:24.419Ebackstab
[build]
Fluffy_Pillow 45.4/100 45% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
1:27.060Neviscerate
[finish]
Fluffy_Pillow 37.8/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
1:28.064Ebackstab
[build]
Fluffy_Pillow 48.6/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
1:29.831Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 31.6/100 32% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
1:30.728Ebackstab
[build]
Fluffy_Pillow 45.2/100 45% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, errant_manaforge_emission, flask_of_alchemical_chaos_crit
1:31.732Jflagellation
[cds]
Fluffy_Pillow 16.0/100 16% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, deeper_daggers, windsingers_runed_citrine_Vers, errant_manaforge_emission, flask_of_alchemical_chaos_crit
1:32.737Hsymbols_of_death
[cds]
Messerknecht 30.8/100 31% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, flagellation_buff, deeper_daggers, windsingers_runed_citrine_Vers, errant_manaforge_emission, flask_of_alchemical_chaos_crit
1:32.737Qshadow_dance
[stealth_cds]
Messerknecht 70.8/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, errant_manaforge_emission, flask_of_alchemical_chaos_crit
1:32.737Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 70.8/100 71% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, errant_manaforge_emission, flask_of_alchemical_chaos_crit
1:32.737Ksecret_technique
[finish]
Fluffy_Pillow 70.8/100 71% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:33.742Dshadowstrike
[build]
Fluffy_Pillow 91.6/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:34.747Neviscerate
[finish]
Fluffy_Pillow 65.4/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(3), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:35.751Dshadowstrike
[build]
Fluffy_Pillow 99.2/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:36.755Ishadow_blades
[cds]
Messerknecht 65.0/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:36.755Mcoup_de_grace
[finish]
Fluffy_Pillow 65.0/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:37.959Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques, flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:38.963Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques, flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:39.967Dshadowstrike
[build]
Fluffy_Pillow 76.6/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques, flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:40.972Lrupture
[finish]
Fluffy_Pillow 50.4/100 50% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:41.975Ebackstab
[build]
Fluffy_Pillow 79.2/100 79% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:42.978Neviscerate
[finish]
Fluffy_Pillow 57.9/100 58% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:43.982Qshadow_dance
[stealth_cds]
Messerknecht 68.7/100 69% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:43.982Fcold_blood
[cds]
Messerknecht 68.7/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), premeditation, flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:43.982Ksecret_technique
[finish]
Fluffy_Pillow 68.7/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, escalating_blade, flawless_form(9), premeditation, flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:44.986Hsymbols_of_death
[cds]
Messerknecht 92.5/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(9), premeditation, shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, storm_sewers_citrine
1:45.022Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes(2), escalating_blade, flawless_form(9), premeditation, shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, storm_sewers_citrine
1:46.028Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, storm_sewers_citrine
1:47.035Dshadowstrike
[build]
Fluffy_Pillow 99.6/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, storm_sewers_citrine
1:48.039Neviscerate
[finish]
Fluffy_Pillow 73.4/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
1:49.045Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(8), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
1:50.051Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(10), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
1:51.055Neviscerate
[finish]
Fluffy_Pillow 92.6/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
1:52.057Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, storm_sewers_citrine
1:53.062Neviscerate
[finish]
Fluffy_Pillow 79.0/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(7), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, storm_sewers_citrine
1:54.066Neviscerate
[finish]
Fluffy_Pillow 98.4/100 98% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:55.069Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:56.075Ebackstab
[build]
Fluffy_Pillow 79.4/100 79% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:57.080Neviscerate
[finish]
Fluffy_Pillow 58.7/100 59% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:58.084Ebackstab
[build]
Fluffy_Pillow 69.5/100 69% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:59.090Ebackstab
[build]
Fluffy_Pillow 48.3/100 48% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:00.928Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:01.932Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(3), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:04.388Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:06.348Lrupture
[finish]
Fluffy_Pillow 26.3/100 26% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:07.352Rvanish
[stealth_cds]
Messerknecht 46.1/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:07.352Dshadowstrike
[build]
Fluffy_Pillow 46.1/100 46% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, premeditation, shadow_techniques(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:09.861Hsymbols_of_death
[cds]
Messerknecht 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(4), poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:10.022Qshadow_dance
[stealth_cds]
Messerknecht 77.8/100 78% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(2), shadow_techniques(4), the_rotten(2), poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:10.022Ksecret_technique
[finish]
Fluffy_Pillow 77.8/100 78% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:11.026Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(4), flawless_form(3), premeditation, shadow_techniques(6), the_rotten(2), poised_shadows, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:12.030Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(8), the_rotten, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:13.237Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques, the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:14.241Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(3), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:15.244Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
2:16.248Dshadowstrike
[build]
Fluffy_Pillow 87.6/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
2:17.252Neviscerate
[finish]
Fluffy_Pillow 53.4/100 53% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_mastery
2:18.256Ebackstab
[build]
Fluffy_Pillow 72.1/100 72% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:19.262Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:21.278Neviscerate
[finish]
Fluffy_Pillow 40.6/100 41% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:22.281Ebackstab
[build]
Fluffy_Pillow 46.4/100 46% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:25.135Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:28.088Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:30.567Ksecret_technique
[finish]
Fluffy_Pillow 31.4/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
2:31.569Ebackstab
[build]
Fluffy_Pillow 51.2/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(3), bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:34.067Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:36.075Lrupture
[finish]
Fluffy_Pillow 30.1/100 30% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form(4), shadow_techniques(2), bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:37.081Ebackstab
[build]
Fluffy_Pillow 45.7/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form(4), shadow_techniques(2), bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:40.088Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form(3), shadow_techniques, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:43.140Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form(3), shadow_techniques(2), stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
2:46.127Mcoup_de_grace
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form, shadow_techniques(2), stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
2:47.332Ebackstab
[build]
Fluffy_Pillow 78.2/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
2:48.337Ebackstab
[build]
Fluffy_Pillow 52.9/100 53% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
2:50.527Neviscerate
[finish]
Fluffy_Pillow 39.8/100 40% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:51.531Ebackstab
[build]
Fluffy_Pillow 45.2/100 45% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:54.891Ebackstab
[build]
Fluffy_Pillow 44.1/100 44% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(5), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:58.079Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:59.760Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 22.6/100 23% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, flawless_form, shadow_techniques, flask_of_alchemical_chaos_mastery
3:00.583Lrupture
[finish]
Fluffy_Pillow 31.2/100 31% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, flawless_form, shadow_techniques, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:01.590Ebackstab
[build]
Fluffy_Pillow 46.7/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form, shadow_techniques, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:04.060Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form, shadow_techniques(2), cryptic_instructions, flask_of_alchemical_chaos_mastery
3:05.066Jflagellation
[cds]
Fluffy_Pillow 15.2/100 15% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form, shadow_techniques, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:06.070Hsymbols_of_death
[cds]
Messerknecht 29.7/100 30% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form, shadow_techniques(2), flagellation_buff, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:06.070Qshadow_dance
[stealth_cds]
Messerknecht 69.7/100 70% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:06.070Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 69.7/100 70% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_mastery
3:06.070Ksecret_technique
[finish]
Fluffy_Pillow 69.7/100 70% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:07.076Dshadowstrike
[build]
Fluffy_Pillow 90.4/100 90% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(9), poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:08.081Ishadow_blades
[cds]
Messerknecht 64.0/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:08.081Neviscerate
[finish]
Fluffy_Pillow 64.0/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:09.085Dshadowstrike
[build]
Fluffy_Pillow 89.7/100 90% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:10.089Neviscerate
[finish]
Fluffy_Pillow 63.5/100 63% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_buff(19), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:11.093Dshadowstrike
[build]
Fluffy_Pillow 82.3/100 82% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_buff(26), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:12.098Mcoup_de_grace
[finish]
Fluffy_Pillow 48.1/100 48% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(8), flagellation_buff(26), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:13.302Neviscerate
[finish]
Fluffy_Pillow 94.1/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:14.307Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:15.312Neviscerate
[finish]
Fluffy_Pillow 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:16.318Hsymbols_of_death
[cds]
Messerknecht 81.6/100 82% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:16.318Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:16.318Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:17.321Fcold_blood
[cds]
Messerknecht 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:17.321Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:18.327Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:19.331Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:20.335Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:21.340Dshadowstrike
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:22.343Neviscerate
[finish]
Fluffy_Pillow 50.4/100 50% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:23.348Dshadowstrike
[build]
Fluffy_Pillow 69.2/100 69% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:24.446Neviscerate
[finish]
Fluffy_Pillow 44.0/100 44% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:25.450Neviscerate
[finish]
Fluffy_Pillow 54.8/100 55% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques, flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:26.454Ebackstab
[build]
Fluffy_Pillow 73.5/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:27.459Ebackstab
[build]
Fluffy_Pillow 44.3/100 44% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:28.463Hsymbols_of_death
[cds]
Messerknecht 23.1/100 23% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:28.463Qshadow_dance
[stealth_cds]
Messerknecht 63.1/100 63% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(3), shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:28.463Neviscerate
[finish]
Fluffy_Pillow 63.1/100 63% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(3), premeditation, shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:29.466Dshadowstrike
[build]
Fluffy_Pillow 86.9/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:30.470Ksecret_technique
[finish]
Fluffy_Pillow 52.7/100 53% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:31.475Dshadowstrike
[build]
Fluffy_Pillow 99.5/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:32.480Neviscerate
[finish]
Fluffy_Pillow 73.3/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:33.485Dshadowstrike
[build]
Fluffy_Pillow 84.1/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
3:34.488Mcoup_de_grace
[finish]
Fluffy_Pillow 49.9/100 50% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:35.694Dshadowstrike
[build]
Fluffy_Pillow 95.8/100 96% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:36.698Lrupture
[finish]
Fluffy_Pillow 69.6/100 70% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:37.702Ebackstab
[build]
Fluffy_Pillow 98.4/100 98% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
3:38.706Ebackstab
[build]
Fluffy_Pillow 77.2/100 77% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:39.713Neviscerate
[finish]
Fluffy_Pillow 48.0/100 48% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
3:40.719Ebackstab
[build]
Fluffy_Pillow 66.8/100 67% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
3:41.724Ebackstab
[build]
Fluffy_Pillow 45.6/100 46% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
3:43.751Neviscerate
[finish]
Fluffy_Pillow 35.4/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
3:44.756Ebackstab
[build]
Fluffy_Pillow 54.2/100 54% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
3:46.906Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:49.664Neviscerate
[finish]
Fluffy_Pillow 39.0/100 39% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:50.668Hsymbols_of_death
[cds]
Messerknecht 49.8/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:50.668Qshadow_dance
[stealth_cds]
Messerknecht 89.8/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:50.668Dshadowstrike
[build]
Fluffy_Pillow 89.8/100 90% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:51.673Ksecret_technique
[finish]
Fluffy_Pillow 63.6/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:52.676Dshadowstrike
[build]
Fluffy_Pillow 94.3/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:53.679Mcoup_de_grace
[finish]
Fluffy_Pillow 68.3/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:54.884Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:55.890Neviscerate
[finish]
Fluffy_Pillow 82.0/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:56.893Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:57.898Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:58.903Ebackstab
[build]
Fluffy_Pillow 85.1/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
3:59.906Ebackstab
[build]
Fluffy_Pillow 64.1/100 64% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:00.911Lrupture
[finish]
Fluffy_Pillow 35.1/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:01.915Ebackstab
[build]
Fluffy_Pillow 64.1/100 64% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:02.918Ebackstab
[build]
Fluffy_Pillow 43.2/100 43% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:04.466Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:05.473Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(8), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:07.670Ebackstab
[build]
Fluffy_Pillow 43.3/100 43% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_crit
4:10.270Ksecret_technique
[finish]
Fluffy_Pillow 35.3/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
4:11.277Rvanish
[stealth_cds]
Messerknecht 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:11.277Dshadowstrike
[build]
Fluffy_Pillow 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form, premeditation, shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:13.700Mcoup_de_grace
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(4), bolstering_shadows, flask_of_alchemical_chaos_crit
4:14.904Ebackstab
[build]
Fluffy_Pillow 78.1/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:15.909Neviscerate
[finish]
Fluffy_Pillow 48.9/100 49% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:16.914Ebackstab
[build]
Fluffy_Pillow 58.7/100 59% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:18.644Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
4:21.610Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:24.408Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques, flask_of_alchemical_chaos_crit
4:25.415Ebackstab
[build]
Fluffy_Pillow 50.0/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:27.952Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
4:30.910Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:32.853Lrupture
[finish]
Fluffy_Pillow 26.0/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), flask_of_alchemical_chaos_crit
4:33.858Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(3), flask_of_alchemical_chaos_crit
4:33.858Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(3), realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
4:34.864Jflagellation
[cds]
Fluffy_Pillow 21.6/100 22% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
4:36.070Hsymbols_of_death
[cds]
Messerknecht 38.5/100 39% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, flagellation_buff, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
4:36.070Qshadow_dance
[stealth_cds]
Messerknecht 78.5/100 79% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
4:36.070Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 78.5/100 79% energy
4.0/7 57% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
4:36.070Ksecret_technique
[finish]
Fluffy_Pillow 78.5/100 79% energy
4.0/7 57% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:37.075Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(8), poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:38.079Ishadow_blades
[cds]
Messerknecht 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(8), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:38.081Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(8), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:39.287Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_buff(23), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:40.291Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(9), flagellation_buff(23), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:41.298Neviscerate
[finish]
Fluffy_Pillow 92.6/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:42.303Hsymbols_of_death
[cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:42.303Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(6), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:43.308Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(6), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:44.315Qshadow_dance
[stealth_cds]
Messerknecht 99.6/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), shadow_techniques(8), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:44.315Dshadowstrike
[build]
Fluffy_Pillow 99.6/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), premeditation, shadow_techniques(8), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:45.319Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), shadow_techniques(10), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:46.325Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:47.331Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:48.336Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:49.340Neviscerate
[finish]
Fluffy_Pillow 93.8/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:50.344Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:51.349Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:52.355Neviscerate
[finish]
Fluffy_Pillow 85.8/100 86% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:53.359Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:54.364Mcoup_de_grace
[finish]
Fluffy_Pillow 79.4/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(5), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:55.566Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:56.569Neviscerate
[finish]
Fluffy_Pillow 79.4/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit16.54%16.97%3476
Haste2.35%2.79%1843
Versatility29.74%22.21%17321
Attack Power6162857457938
Mastery66.00%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Messerknecht"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385,crafted_stats=32/49
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460,crafted_stats=40/32

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Simulation & Raid Information

Iterations: 1226
Threads: 12
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.4 )

Performance:

Total Events Processed: 21119046
Max Event Queue: 554
Sim Seconds: 368315
CPU Seconds: 48.5781
Physical Seconds: 4.6121
Speed Up: 7582

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Combo 1 Combo 1 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 1 Combo 1 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.16sec 0 300.42sec
Combo 1 Combo 1 auto_attack_mh 0 14125133 47018 70.99 38377 77441 355.4 355.4 19.5% 16.3% 0.0% 0.0% 0.98sec 18427831 300.42sec
Combo 1 Combo 1 auto_attack_oh 1 7021313 23372 70.85 19125 38591 354.8 354.8 19.4% 16.3% 0.0% 0.0% 0.99sec 9159628 300.42sec
Combo 1 Combo 1 backstab 53 9126677 30380 15.09 72929 188468 75.6 75.6 41.4% 0.0% 0.0% 0.0% 3.66sec 11939790 300.42sec
Combo 1 Combo 1 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.67sec 0 300.42sec
Combo 1 Combo 1 coup_de_grace 441776 26839164 89339 7.96 520004 1044923 13.3 39.9 29.2% 0.0% 0.0% 0.0% 22.30sec 34943574 300.42sec
Combo 1 Combo 1 eviscerate_coup_de_grace_bonus 462244 11484312 38228 7.66 230305 466256 0.0 38.4 29.3% 0.0% 0.0% 0.0% 0.00sec 11484312 300.42sec
Combo 1 Combo 1 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 92.34sec 0 300.42sec
Combo 1 Combo 1 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 1 Combo 1 elemental_focusing_lens_onyx 461191 5970886 19875 4.42 269706 0 22.1 22.1 0.0% 0.0% 0.0% 0.0% 13.12sec 5970886 300.42sec
Combo 1 Combo 1 eviscerate 196819 76879968 255909 13.74 857358 1756288 68.8 68.8 29.0% 0.0% 0.0% 0.0% 4.40sec 100002892 300.42sec
Combo 1 Combo 1 eviscerate_bonus 328082 33131577 110284 13.49 376457 770569 67.6 67.6 28.9% 0.0% 0.0% 0.0% 4.46sec 33131577 300.42sec
Combo 1 Combo 1 flagellation 384631 308967 1028 0.74 69720 139368 3.7 3.7 19.5% 0.0% 0.0% 0.0% 91.38sec 308967 300.42sec
Combo 1 Combo 1 flagellation_damage 394757 6009477 20004 4.77 209360 421548 0.0 23.9 19.9% 0.0% 0.0% 0.0% 0.00sec 6009477 300.42sec
Combo 1 Combo 1 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 1 Combo 1 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 1 Combo 1 instant_poison 315585 3663512 12195 56.70 10791 21721 0.0 283.9 19.3% 0.0% 0.0% 0.0% 0.00sec 3663512 300.42sec
Combo 1 Combo 1 legendary_skippers_citrine 462962 0 0 0.00 0 0 25.4 0.0 0.0% 0.0% 0.0% 0.0% 11.74sec 0 300.42sec
Combo 1 Combo 1 mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 71.40sec 0 300.42sec
Combo 1 Combo 1 old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 67.99sec 0 300.42sec
Combo 1 Combo 1 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 310.63sec 0 300.42sec
Combo 1 Combo 1 recuperator 426605 0 0 0.00 0 0 99.0 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 300.42sec
Combo 1 Combo 1 roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 77.27sec 0 300.42sec
Combo 1 Combo 1 rupture ticks -1943 29627470 98758 33.53 135881 280761 9.5 167.7 28.2% 0.0% 0.0% 0.0% 31.21sec 29627470 300.42sec
Combo 1 Combo 1 rupture_replicating_shadows ticks -394031 5455885 18186 0.00 24958 51854 167.7 0.0 28.2% 0.0% 0.0% 0.0% 1.76sec 5455885 300.42sec
Combo 1 Combo 1 secret_technique 280719 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 18.92sec 0 300.42sec
Combo 1 Combo 1 secret_technique_player 280720 20889173 69533 3.21 686909 2109230 0.0 16.1 43.2% 0.0% 0.0% 0.0% 0.00sec 27228882 300.42sec
Combo 1 Combo 1 secret_technique_clones 282449 60637058 201841 6.40 995182 3024513 0.0 32.0 44.3% 0.0% 0.0% 0.0% 0.00sec 60637058 300.42sec
Combo 1 Combo 1 shadow_blades 121471 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.84sec 0 300.42sec
Combo 1 Combo 1 shadow_blades_attack ticks -279043 31433706 104779 0.00 81632 0 385.0 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 31433706 300.42sec
Combo 1 Combo 1 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.25sec 0 300.42sec
Combo 1 Combo 1 shadowstrike 185438 35290136 117469 10.47 280429 916923 52.4 52.4 61.8% 0.0% 0.0% 0.0% 5.88sec 46012041 300.42sec
Combo 1 Combo 1 squall_sailors_citrine 462952 1079813 3594 0.45 400848 803311 2.3 2.3 18.9% 0.0% 0.0% 0.0% 79.25sec 1079813 300.42sec
Combo 1 Combo 1 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 1 Combo 1 storm_sewers_citrine 462958 0 0 0.47 0 0 2.4 2.4 0.0% 0.0% 0.0% 0.0% 69.76sec 1615945 300.42sec
Combo 1 Combo 1 storm_sewers_citrine_damage 468422 257882 858 0.47 91544 183447 2.4 2.4 19.5% 0.0% 0.0% 0.0% 69.76sec 257882 300.42sec
Combo 1 Combo 1 suffocating_darkness ticks -449217 14156509 47188 21.47 131852 0 19.1 107.3 0.0% 0.0% 0.0% 0.0% 15.22sec 14156509 300.42sec
Combo 1 Combo 1 symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.44sec 0 300.42sec
Combo 1 Combo 1 thunderlords_crackling_citrine 462951 19311484 64282 6.47 498710 999595 32.4 32.4 19.3% 0.0% 0.0% 0.0% 9.08sec 19311484 300.42sec
Combo 1 Combo 1 undersea_overseers_citrine 462953 1357170 4518 0.47 481259 962877 2.4 2.4 18.8% 0.0% 0.0% 0.0% 73.81sec 1357170 300.42sec
Combo 1 Combo 1 unseen_blade 441144 25589420 85179 11.62 367865 737905 58.2 58.2 19.5% 0.0% 0.0% 0.0% 5.17sec 33424644 300.42sec
Combo 1 Combo 1 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.16sec 0 300.42sec
Combo 1 Combo 1 windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 74.39sec 0 300.42sec
Combo 2 Combo 2 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 2 Combo 2 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.13sec 0 300.42sec
Combo 2 Combo 2 auto_attack_mh 0 14392972 47910 70.96 38069 76722 355.3 355.3 22.4% 16.3% 0.0% 0.0% 0.99sec 18764557 300.42sec
Combo 2 Combo 2 auto_attack_oh 1 7156739 23822 70.79 18971 38223 354.4 354.4 22.5% 16.4% 0.0% 0.0% 0.99sec 9330186 300.42sec
Combo 2 Combo 2 backstab 53 9289178 30921 15.08 72380 186712 75.5 75.5 44.3% 0.0% 0.0% 0.0% 3.67sec 12140055 300.42sec
Combo 2 Combo 2 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.74sec 0 300.42sec
Combo 2 Combo 2 coup_de_grace 441776 26380526 87812 7.95 499288 1002262 13.3 39.8 32.4% 0.0% 0.0% 0.0% 22.22sec 34341363 300.42sec
Combo 2 Combo 2 eviscerate_coup_de_grace_bonus 462244 11282892 37557 7.68 221549 442488 0.0 38.5 32.5% 0.0% 0.0% 0.0% 0.00sec 11282892 300.42sec
Combo 2 Combo 2 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.45sec 0 300.42sec
Combo 2 Combo 2 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 2 Combo 2 elemental_focusing_lens_onyx 461191 5972968 19882 4.46 267217 0 22.4 22.4 0.0% 0.0% 0.0% 0.0% 12.99sec 5972968 300.42sec
Combo 2 Combo 2 eviscerate 196819 75550613 251484 13.73 821868 1677658 68.7 68.7 32.4% 0.0% 0.0% 0.0% 4.40sec 98266542 300.42sec
Combo 2 Combo 2 eviscerate_bonus 328082 32439279 107980 13.52 360398 733595 67.7 67.7 31.8% 0.0% 0.0% 0.0% 4.46sec 32439279 300.42sec
Combo 2 Combo 2 flagellation 384631 314987 1048 0.74 69185 138432 3.7 3.7 22.5% 0.0% 0.0% 0.0% 91.35sec 314987 300.42sec
Combo 2 Combo 2 flagellation_damage 394757 6091654 20277 4.77 207845 414442 0.0 23.9 22.9% 0.0% 0.0% 0.0% 0.00sec 6091654 300.42sec
Combo 2 Combo 2 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 2 Combo 2 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 2 Combo 2 instant_poison 315585 3733040 12426 56.78 10697 21545 0.0 284.3 22.4% 0.0% 0.0% 0.0% 0.00sec 3733040 300.42sec
Combo 2 Combo 2 legendary_skippers_citrine 462962 0 0 0.00 0 0 25.4 0.0 0.0% 0.0% 0.0% 0.0% 11.74sec 0 300.42sec
Combo 2 Combo 2 mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 76.51sec 0 300.42sec
Combo 2 Combo 2 old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 73.44sec 0 300.42sec
Combo 2 Combo 2 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 310.67sec 0 300.42sec
Combo 2 Combo 2 recuperator 426605 0 0 0.00 0 0 99.0 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 300.42sec
Combo 2 Combo 2 roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 72.96sec 0 300.42sec
Combo 2 Combo 2 rupture ticks -1943 29025290 96751 33.52 129778 268196 9.5 167.6 31.4% 0.0% 0.0% 0.0% 31.38sec 29025290 300.42sec
Combo 2 Combo 2 rupture_replicating_shadows ticks -394031 5335764 17786 0.00 23862 49358 167.6 0.0 31.3% 0.0% 0.0% 0.0% 1.77sec 5335764 300.42sec
Combo 2 Combo 2 secret_technique 280719 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 18.93sec 0 300.42sec
Combo 2 Combo 2 secret_technique_player 280720 20316453 67627 3.21 655915 1981634 0.0 16.1 46.0% 0.0% 0.0% 0.0% 0.00sec 26468284 300.42sec
Combo 2 Combo 2 secret_technique_clones 282449 58803695 195738 6.39 946056 2863272 0.0 32.0 46.5% 0.0% 0.0% 0.0% 0.00sec 58803695 300.42sec
Combo 2 Combo 2 shadow_blades 121471 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.91sec 0 300.42sec
Combo 2 Combo 2 shadow_blades_attack ticks -279043 31018573 103395 0.00 80528 0 385.2 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 31018573 300.42sec
Combo 2 Combo 2 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.29sec 0 300.42sec
Combo 2 Combo 2 shadowstrike 185438 35325248 117586 10.47 278338 903745 52.4 52.4 63.2% 0.0% 0.0% 0.0% 5.89sec 46038269 300.42sec
Combo 2 Combo 2 squall_sailors_citrine 462952 1114304 3709 0.47 389480 776520 2.3 2.3 22.2% 0.0% 0.0% 0.0% 74.23sec 1114304 300.42sec
Combo 2 Combo 2 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 2 Combo 2 storm_sewers_citrine 462958 0 0 0.47 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 70.69sec 1553433 300.42sec
Combo 2 Combo 2 storm_sewers_citrine_damage 468422 251839 838 0.47 87994 177327 2.3 2.3 22.4% 0.0% 0.0% 0.0% 70.69sec 251839 300.42sec
Combo 2 Combo 2 suffocating_darkness ticks -449217 14038293 46794 21.47 130858 0 19.2 107.3 0.0% 0.0% 0.0% 0.0% 14.70sec 14038293 300.42sec
Combo 2 Combo 2 symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.45sec 0 300.42sec
Combo 2 Combo 2 thunderlords_crackling_citrine 462951 19261007 64114 6.50 484057 970474 32.6 32.6 22.1% 0.0% 0.0% 0.0% 8.80sec 19261007 300.42sec
Combo 2 Combo 2 undersea_overseers_citrine 462953 1367859 4553 0.47 467016 937169 2.4 2.4 23.7% 0.0% 0.0% 0.0% 71.42sec 1367859 300.42sec
Combo 2 Combo 2 unseen_blade 441144 26048811 86708 11.63 364460 733047 58.3 58.3 22.4% 0.0% 0.0% 0.0% 5.12sec 34005163 300.42sec
Combo 2 Combo 2 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.13sec 0 300.42sec
Combo 2 Combo 2 windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 74.41sec 0 300.42sec
Combo 3 Combo 3 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 3 Combo 3 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.39sec 0 300.42sec
Combo 3 Combo 3 auto_attack_mh 0 14894678 49580 70.81 39553 79743 354.6 354.6 22.2% 16.3% 0.0% 0.0% 0.99sec 19421432 300.42sec
Combo 3 Combo 3 auto_attack_oh 1 7417714 24691 70.68 19702 39749 353.9 353.9 22.3% 16.3% 0.0% 0.0% 0.99sec 9672219 300.42sec
Combo 3 Combo 3 backstab 53 9612761 31998 15.04 75238 194300 75.3 75.3 44.0% 0.0% 0.0% 0.0% 3.69sec 12564822 300.42sec
Combo 3 Combo 3 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.84sec 0 300.42sec
Combo 3 Combo 3 coup_de_grace 441776 26960799 89744 7.94 511130 1030657 13.3 39.8 32.2% 0.0% 0.0% 0.0% 22.48sec 35092375 300.42sec
Combo 3 Combo 3 eviscerate_coup_de_grace_bonus 462244 11523513 38358 7.69 226087 456001 0.0 38.5 31.9% 0.0% 0.0% 0.0% 0.00sec 11523513 300.42sec
Combo 3 Combo 3 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 92.69sec 0 300.42sec
Combo 3 Combo 3 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 3 Combo 3 elemental_focusing_lens_onyx 461191 6230721 20740 4.48 277789 0 22.4 22.4 0.0% 0.0% 0.0% 0.0% 12.80sec 6230721 300.42sec
Combo 3 Combo 3 eviscerate 196819 77186897 256930 13.72 844810 1725927 68.7 68.7 31.7% 0.0% 0.0% 0.0% 4.38sec 100396639 300.42sec
Combo 3 Combo 3 eviscerate_bonus 328082 33366718 111067 13.51 370911 753657 67.6 67.6 32.0% 0.0% 0.0% 0.0% 4.45sec 33366718 300.42sec
Combo 3 Combo 3 flagellation 384631 326014 1085 0.74 72074 143861 3.7 3.7 21.7% 0.0% 0.0% 0.0% 91.43sec 326014 300.42sec
Combo 3 Combo 3 flagellation_damage 394757 6298445 20965 4.75 215856 431835 0.0 23.8 22.7% 0.0% 0.0% 0.0% 0.00sec 6298445 300.42sec
Combo 3 Combo 3 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 3 Combo 3 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 3 Combo 3 instant_poison 315585 3856899 12838 56.54 11111 22397 0.0 283.1 22.3% 0.0% 0.0% 0.0% 0.00sec 3856899 300.42sec
Combo 3 Combo 3 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 310.68sec 0 300.42sec
Combo 3 Combo 3 recuperator 426605 0 0 0.00 0 0 99.0 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 300.42sec
Combo 3 Combo 3 rupture ticks -1943 29595055 98650 33.45 133198 274862 9.5 167.2 30.9% 0.0% 0.0% 0.0% 31.35sec 29595055 300.42sec
Combo 3 Combo 3 rupture_replicating_shadows ticks -394031 5453468 18178 0.00 24478 50673 167.2 0.0 31.0% 0.0% 0.0% 0.0% 1.77sec 5453468 300.42sec
Combo 3 Combo 3 secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 18.98sec 0 300.42sec
Combo 3 Combo 3 secret_technique_player 280720 20879409 69501 3.20 669212 2052851 0.0 16.0 45.7% 0.0% 0.0% 0.0% 0.00sec 27205629 300.42sec
Combo 3 Combo 3 secret_technique_clones 282449 60174947 200303 6.39 975062 2948447 0.0 32.0 45.9% 0.0% 0.0% 0.0% 0.00sec 60174947 300.42sec
Combo 3 Combo 3 shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.97sec 0 300.42sec
Combo 3 Combo 3 shadow_blades_attack ticks -279043 31971378 106571 0.00 83125 0 384.7 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 31971378 300.42sec
Combo 3 Combo 3 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.26sec 0 300.42sec
Combo 3 Combo 3 shadowstrike 185438 36624999 121913 10.49 288927 937560 52.5 52.5 63.0% 0.0% 0.0% 0.0% 5.84sec 47739248 300.42sec
Combo 3 Combo 3 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Combo 3 Combo 3 suffocating_darkness ticks -449217 14664996 48883 21.53 136279 0 19.2 107.6 0.0% 0.0% 0.0% 0.0% 15.40sec 14664996 300.42sec
Combo 3 Combo 3 symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.43sec 0 300.42sec
Combo 3 Combo 3 unseen_blade 441144 26956491 89729 11.60 379309 760168 58.1 58.1 22.3% 0.0% 0.0% 0.0% 5.18sec 35195483 300.42sec
Combo 3 Combo 3 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.39sec 0 300.42sec
Messerknecht Messerknecht augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Messerknecht Messerknecht auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.45sec 0 300.42sec
Messerknecht Messerknecht auto_attack_mh 0 14102296 46942 70.98 38384 77386 355.4 355.4 19.4% 16.3% 0.0% 0.0% 0.98sec 18399165 300.42sec
Messerknecht Messerknecht auto_attack_oh 1 7004333 23315 70.85 19122 38512 354.8 354.8 19.4% 16.4% 0.0% 0.0% 0.98sec 9138651 300.42sec
Messerknecht Messerknecht backstab 53 9093754 30270 15.10 72895 188652 75.6 75.6 41.0% 0.0% 0.0% 0.0% 3.70sec 11898212 300.42sec
Messerknecht Messerknecht cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.57sec 0 300.42sec
Messerknecht Messerknecht coup_de_grace 441776 27071096 90111 7.99 519254 1054662 13.4 40.0 29.4% 0.0% 0.0% 0.0% 22.21sec 35243084 300.42sec
Messerknecht Messerknecht eviscerate_coup_de_grace_bonus 462244 11555195 38464 7.69 231228 464939 0.0 38.5 29.5% 0.0% 0.0% 0.0% 0.00sec 11555195 300.42sec
Messerknecht Messerknecht cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 92.12sec 0 300.42sec
Messerknecht Messerknecht elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Messerknecht Messerknecht elemental_focusing_lens_onyx 461191 6026184 20059 4.46 269579 0 22.4 22.4 0.0% 0.0% 0.0% 0.0% 12.83sec 6026184 300.42sec
Messerknecht Messerknecht eviscerate 196819 76866036 255862 13.74 854559 1759726 68.8 68.8 29.1% 0.0% 0.0% 0.0% 4.38sec 99988482 300.42sec
Messerknecht Messerknecht eviscerate_bonus 328082 33044405 109994 13.48 376763 765708 67.5 67.5 29.1% 0.0% 0.0% 0.0% 4.45sec 33044405 300.42sec
Messerknecht Messerknecht flagellation 384631 309739 1031 0.74 69809 139532 3.7 3.7 19.6% 0.0% 0.0% 0.0% 91.20sec 309739 300.42sec
Messerknecht Messerknecht flagellation_damage 394757 5986261 19926 4.76 209815 418673 0.0 23.8 19.8% 0.0% 0.0% 0.0% 0.00sec 5986261 300.42sec
Messerknecht Messerknecht flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Messerknecht Messerknecht food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Messerknecht Messerknecht instant_poison 315585 3663169 12194 56.68 10792 21747 0.0 283.8 19.3% 0.0% 0.0% 0.0% 0.00sec 3663169 300.42sec
Messerknecht Messerknecht legendary_skippers_citrine 462962 0 0 0.00 0 0 25.4 0.0 0.0% 0.0% 0.0% 0.0% 11.31sec 0 300.42sec
Messerknecht Messerknecht mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 76.70sec 0 300.42sec
Messerknecht Messerknecht old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 66.37sec 0 300.42sec
Messerknecht Messerknecht potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 310.65sec 0 300.42sec
Messerknecht Messerknecht recuperator 426605 0 0 0.00 0 0 99.0 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 300.42sec
Messerknecht Messerknecht roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 70.60sec 0 300.42sec
Messerknecht Messerknecht rupture ticks -1943 29676193 98921 33.52 135733 281027 9.6 167.6 28.5% 0.0% 0.0% 0.0% 31.28sec 29676193 300.42sec
Messerknecht Messerknecht rupture_replicating_shadows ticks -394031 5462918 18210 0.00 24961 51719 167.6 0.0 28.5% 0.0% 0.0% 0.0% 1.76sec 5462918 300.42sec
Messerknecht Messerknecht secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 19.07sec 0 300.42sec
Messerknecht Messerknecht secret_technique_player 280720 20965717 69788 3.20 683718 2123109 0.0 16.0 43.4% 0.0% 0.0% 0.0% 0.00sec 27329339 300.42sec
Messerknecht Messerknecht secret_technique_clones 282449 60687448 202009 6.38 995777 3037265 0.0 32.0 44.2% 0.0% 0.0% 0.0% 0.00sec 60687448 300.42sec
Messerknecht Messerknecht shadow_blades 121471 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.74sec 0 300.42sec
Messerknecht Messerknecht shadow_blades_attack ticks -279043 31425629 104752 0.00 81652 0 384.9 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 31425629 300.42sec
Messerknecht Messerknecht shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.18sec 0 300.42sec
Messerknecht Messerknecht shadowstrike 185438 35313909 117549 10.47 280865 915927 52.4 52.4 61.8% 0.0% 0.0% 0.0% 5.81sec 46042929 300.42sec
Messerknecht Messerknecht squall_sailors_citrine 462952 1131665 3767 0.47 400753 801742 2.3 2.3 20.9% 0.0% 0.0% 0.0% 67.94sec 1131665 300.42sec
Messerknecht Messerknecht stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Messerknecht Messerknecht storm_sewers_citrine 462958 0 0 0.45 0 0 2.2 2.2 0.0% 0.0% 0.0% 0.0% 75.79sec 1540810 300.42sec
Messerknecht Messerknecht storm_sewers_citrine_damage 468422 244227 813 0.45 91368 183519 2.2 2.2 18.8% 0.0% 0.0% 0.0% 75.79sec 244227 300.42sec
Messerknecht Messerknecht suffocating_darkness ticks -449217 14092821 46976 21.49 131223 0 19.1 107.5 0.0% 0.0% 0.0% 0.0% 15.34sec 14092821 300.42sec
Messerknecht Messerknecht symbols_of_death 212283 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.42sec 0 300.42sec
Messerknecht Messerknecht thunderlords_crackling_citrine 462951 19418309 64637 6.51 498824 999148 32.6 32.6 19.3% 0.0% 0.0% 0.0% 9.29sec 19418309 300.42sec
Messerknecht Messerknecht undersea_overseers_citrine 462953 1361354 4532 0.47 480999 960617 2.4 2.4 19.4% 0.0% 0.0% 0.0% 78.30sec 1361354 300.42sec
Messerknecht Messerknecht unseen_blade 441144 25664837 85430 11.66 367466 739669 58.4 58.4 19.4% 0.0% 0.0% 0.0% 5.15sec 33524425 300.42sec
Messerknecht Messerknecht vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.45sec 0 300.42sec
Messerknecht Messerknecht windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.2 0.0 0.0% 0.0% 0.0% 0.0% 74.04sec 0 300.42sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health5,476,889.30.00.00%0.0100.0%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Fazed8.749.735.8s5.2s30.9s89.62%89.66%49.7 (49.7)7.8

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 156.5s
  • trigger_min/max:1.0s / 24.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 153.0s
  • uptime_min/max:79.62% / 98.60%

Stack Uptimes

  • fazed_1:89.62%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.849.435.6s5.2s30.5s89.44%89.50%49.4 (49.4)7.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 150.4s
  • trigger_min/max:1.0s / 24.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 161.7s
  • uptime_min/max:78.91% / 98.58%

Stack Uptimes

  • fazed_1:89.44%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.849.535.5s5.2s30.6s89.64%89.67%49.5 (49.5)7.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 159.5s
  • trigger_min/max:1.0s / 25.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 158.2s
  • uptime_min/max:80.87% / 98.22%

Stack Uptimes

  • fazed_1:89.64%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.949.235.3s5.2s30.3s89.47%89.51%49.2 (49.2)7.9

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 151.9s
  • trigger_min/max:1.0s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 143.2s
  • uptime_min/max:79.37% / 97.71%

Stack Uptimes

  • fazed_1:89.47%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.778.765.1s3.6s60.7s94.66%94.66%78.7 (78.7)3.7

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 277.6s
  • trigger_min/max:1.0s / 52.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 335.5s
  • uptime_min/max:78.87% / 100.00%

Stack Uptimes

  • find_weakness_1:94.66%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.679.166.0s3.6s61.6s94.77%94.77%79.1 (79.1)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 277.5s
  • trigger_min/max:1.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.8s
  • uptime_min/max:81.50% / 100.00%

Stack Uptimes

  • find_weakness_1:94.77%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.281.772.9s3.5s68.5s95.78%95.72%81.7 (81.7)3.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 323.3s
  • trigger_min/max:1.0s / 43.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 321.4s
  • uptime_min/max:83.70% / 100.00%

Stack Uptimes

  • find_weakness_1:95.78%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.381.471.4s3.5s66.9s95.52%95.52%81.4 (81.4)3.3

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 331.0s
  • trigger_min/max:1.0s / 40.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 326.2s
  • uptime_min/max:85.55% / 100.00%

Stack Uptimes

  • find_weakness_1:95.52%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation3.70.091.0s91.3s11.8s14.62%22.15%0.0 (0.0)3.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 97.8s
  • trigger_min/max:90.0s / 97.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:13.00% / 16.90%

Stack Uptimes

  • flagellation_1:14.62%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.8s14.63%22.21%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.1s
  • trigger_min/max:90.0s / 98.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s
  • uptime_min/max:12.97% / 16.87%

Stack Uptimes

  • flagellation_1:14.63%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.8s14.63%22.19%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.0s
  • trigger_min/max:90.0s / 98.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:13.01% / 16.94%

Stack Uptimes

  • flagellation_1:14.63%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.8s14.63%22.14%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.3s
  • trigger_min/max:90.0s / 98.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.97% / 16.90%

Stack Uptimes

  • flagellation_1:14.63%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1214
Mean 300.42
Minimum 240.02
Maximum 359.88
Spread ( max - min ) 119.87
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
Fluffy_Pillow Damage Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1214
Mean 5792036.13
Minimum 5426190.43
Maximum 6201700.42
Spread ( max - min ) 775509.99
Range [ ( max - min ) / 2 * 100% ] 6.69%
Standard Deviation 140498.2716
5th Percentile 5566252.87
95th Percentile 6023994.70
( 95th Percentile - 5th Percentile ) 457741.83
Mean Distribution
Standard Deviation 4032.3817
95.00% Confidence Interval ( 5784132.80 - 5799939.45 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2261
0.1 Scale Factor Error with Delta=300 168509982
0.05 Scale Factor Error with Delta=300 674039928
0.01 Scale Factor Error with Delta=300 16850998194
HPS
Fluffy_Pillow Healing Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1214
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health020158366740
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.